KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_13570Help
Entry
I653_13570        CDS       T02520                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00020  Citrate cycle (TCA cycle)
bsy00190  Oxidative phosphorylation
bsy00650  Butanoate metabolism
bsy01100  Metabolic pathways
bsy01110  Biosynthesis of secondary metabolites
bsy01120  Microbial metabolism in diverse environments
bsy01130  Biosynthesis of antibiotics
bsy01200  Carbon metabolism
Module
bsy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I653_13570 (sdhA)
   00650 Butanoate metabolism
    I653_13570 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    I653_13570 (sdhA)
Enzymes [BR:bsy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     I653_13570 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     I653_13570 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored Not3 DAO DUF844 AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGI29961
LinkDB All DBs
Position
complement(2681101..2682861)
Genome map
AA seq 586 aa AA seqDB search
MSQSSIIVVGGGLAGLMATIKAAESGMAVKLFSIVPVKRSHSVCAQGGINGAVNTKGEGD
SPWEHFDDTVYGGDFLANQPPVKAMCEAAPSIIHLLDRMGVMFNRTPEGLLDFRRFGGTQ
HHRTAYAGATTGQQLLYALDEQVRRYEVAGLVTKYEGWEFLGAVLDDDRTCRGIVAQNLT
NMQIESFRSDAVIMATGGPGIIFGKSTNSMINTGSAASIVYQQGAYYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFMGDDPRKLPMKIFPAVHYSMGGLWV
DYDQMTNIPGLFAAGECDYSMHGGNRLGANSLLSAIYGGMVAGPNAVKYVNGLESSAEDM
SSSLFDAHVKKEEEKWADIMSMDGTENAYVLHKELGEWMTANVTVVRHNDKLLKTDDKIQ
ELMERFKKININDTTKWSNQGAMFTRQFSNMLQLARVITLGAYNRNESRGAHYKPDYPER
NDDEWLKTTMAKHVSPYEAPEFEYQDVDVSLITPRKRDYSKKKVAK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatcaagcattatcgtagtcggcgggggtcttgccggcctcatggcgacaatt
aaagcagcggaatcaggaatggcggttaagctgttttccattgttcctgtcaaacgttct
cattcggtttgtgcgcaaggtggcataaacggagcggtcaatacaaaaggggaaggtgac
tctccgtgggaacattttgatgacacggtatacgggggagactttcttgccaaccagccg
ccggtcaaggcgatgtgtgaagcggcgccttctatcatccacttattagaccggatgggc
gtcatgtttaaccggacgcctgaaggcctgcttgatttccgccgattcgggggtacacag
caccacagaactgcttatgctggtgcgacgacgggacagcagctgctttacgcactggac
gagcaagtccgcagatacgaagttgcgggtctggtcacaaaatacgaaggctgggaattc
cttggcgctgttttagatgatgacagaacctgccgcggaattgttgcacaaaacctgaca
aacatgcaaattgaatccttccgttcagacgctgtcattatggcgacgggcggaccggga
atcatttttggaaaatcaacgaactccatgattaatacaggatctgctgcatcaatcgtt
tatcagcagggagcgtattatgcaaacggagaattcattcaaatccacccgacagccata
ccgggcgatgacaaactaagactgatgagtgaatcagcgcgtggagaaggcgggcgcgtg
tggacatataaagacggcaaaccgtggtatttcctggaggaaaaatatccggcatacgga
aacctggtgccgcgtgatattgcgacacgcgaaatatttgatgtgtgtgtgaaccagaag
ctcggcattaacggtgaaaacatggtatatctcgatctgtctcataaagatccgaaagag
cttgatattaagcttggcggcatcattgagatttatgagaaattcatgggagacgacccg
cggaagcttccaatgaaaatcttcccggcggtccattattctatgggcggtttatgggtg
gattacgatcaaatgacaaacatccctggactgtttgcggctggggaatgtgattattct
atgcacggcggcaaccgcttgggagcgaactccctgctgtctgcgatttacggaggcatg
gtggccggaccgaatgcggtgaaatatgtaaacggcttagaatcttcagcggaagacatg
tcttcatccctattcgacgctcatgttaagaaagaagaagaaaaatgggctgatattatg
agtatggacggaaccgaaaatgcctatgttcttcacaaagagctcggtgagtggatgacg
gcgaacgtaacggttgtccgccataatgacaagcttttgaaaacggatgacaaaattcag
gagttaatggagcgcttcaaaaagatcaacatcaatgacacgacaaaatggagcaaccag
ggagcgatgttcacacgccagttctcgaacatgcttcagcttgcgagggtgattaccctt
ggcgcatacaaccgtaatgaaagccggggcgcccattataaaccagattatcctgaacgt
aatgatgacgaatggctcaaaacaacaatggctaaacatgtaagcccgtatgaagcgccg
gaatttgagtatcaggatgtcgatgtatcactgataacgcctcggaaacgggattactcg
aagaagaaggtggcgaaataa

DBGET integrated database retrieval system