KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_13945Help
Entry
I653_13945        CDS       T02520                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00010  Glycolysis / Gluconeogenesis
bsy00030  Pentose phosphate pathway
bsy00051  Fructose and mannose metabolism
bsy00052  Galactose metabolism
bsy00680  Methane metabolism
bsy01100  Metabolic pathways
bsy01110  Biosynthesis of secondary metabolites
bsy01120  Microbial metabolism in diverse environments
bsy01130  Biosynthesis of antibiotics
bsy01200  Carbon metabolism
bsy01230  Biosynthesis of amino acids
bsy03018  RNA degradation
Module
bsy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsy_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I653_13945
   00030 Pentose phosphate pathway
    I653_13945
   00051 Fructose and mannose metabolism
    I653_13945
   00052 Galactose metabolism
    I653_13945
  09102 Energy metabolism
   00680 Methane metabolism
    I653_13945
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    I653_13945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bsy01009]
    I653_13945
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsy03019]
    I653_13945
Enzymes [BR:bsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     I653_13945
Protein phosphatases and associated proteins [BR:bsy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     I653_13945
Messenger RNA biogenesis [BR:bsy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     I653_13945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AGI30036
LinkDB All DBs
Structure
PDB: 

Position
complement(2761520..2762479)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAADRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMHEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSAADRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEIL
ETKHTVEQNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataggggtattaacgagcggcggggattccccgggaatgaacgcagcagat
cgcgcagtagtcagaaaggcgatctatcatgacgttgaagtttacggtatttacaacgga
tacgcgggattgatcagcggaaagattgaaaagcttgaactcggatcagtaggcgatatt
atacatcgtggaggaactaagctttatacggcaaggtgtcctgaattcaaaacagttgaa
ggccgtgaaaaagggatagaaaacttgaagaagcttggtattgaaggccttgttgttatc
ggcggagacggttcatatatgggtgcgaaaaaattaacggaacacgggtttccatgtgta
ggtgtaccgggtacaatcgataatgacattccgggcactgattttacaatcggtttcgat
acagctttaaatacagtaattgacgcaattgataagattcgcgatacagcgacttctcat
gaacgtacatatgtaatcgaagtaatgggccgtcatgccggcgatattgcattgtgggcc
ggtcttgcagggggcgcggaatcgatcttaatccctgaggcagactatgacatgcacgaa
atcattgctcgcttaaaacgcggccacgaacgcggcaagaaacacagtattattattgtt
gccgaaggtgtaggcagcggtgttgaattcgggaaacgcatcgaagaagaaacaaacctt
gaaactagggtatctgtattgggccatatccagcgcggaggttctccgagtgctgctgac
cgtgtgttagcaagccgtctcggcgcatatgcagttgaactgctgcttgaaggaaaaggc
ggacgctgtgtaggtatacaaaacaataagcttgtagaccatgatattatagaaatactg
gagacaaaacacacagttgagcaaaacatgtatcagctttcaaaagaactgtctatctaa

DBGET integrated database retrieval system