KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_14145Help
Entry
I653_14145        CDS       T02520                                 

Definition
(GenBank) hypothetical protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00010  Glycolysis / Gluconeogenesis
bsy00620  Pyruvate metabolism
bsy00630  Glyoxylate and dicarboxylate metabolism
bsy00640  Propanoate metabolism
bsy00680  Methane metabolism
bsy01100  Metabolic pathways
bsy01110  Biosynthesis of secondary metabolites
bsy01120  Microbial metabolism in diverse environments
bsy01130  Biosynthesis of antibiotics
bsy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I653_14145
   00620 Pyruvate metabolism
    I653_14145
   00630 Glyoxylate and dicarboxylate metabolism
    I653_14145
   00640 Propanoate metabolism
    I653_14145
  09102 Energy metabolism
   00680 Methane metabolism
    I653_14145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsy01004]
    I653_14145
Enzymes [BR:bsy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     I653_14145
Lipid biosynthesis proteins [BR:bsy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   I653_14145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AGI30076
LinkDB All DBs
Position
complement(2798598..2800187)
Genome map
AA seq 529 aa AA seqDB search
MLKREDLIAPMQYNLVNEMEKFSAAGQKTALLWEDESGKQESWSYEKLMEETNKIGAALA
DLGFKKGDKLIVMVPRVLEAYAVYLAILKSGMVVIPCSEMLRAKDLEYRIEHAEVKGAIV
YSKFIGAFRDVSTADKLITLSIGENDAGWKNLLSIEADGSQFKTADTTRDDMAFLSYTSG
TTGQPKGVVHTHGWAFAHLKTSAGAWLDISEKDIVWATAAPGWQKWVWSPFLAVLGSGAT
GFVYHGRFKAEKYLELLNRYKINVFCCTPTEYRLMAKVEGLDRFDLSALHSAVSAGEPLN
REVIDVFQKHFGIKVRDGYGQTESTLLVGVLKDTPIKPGSMGKPTPGNQVEIINEDGEIC
KPGEVGDIAVHLSTPALFKEYFKDPERMKTQIRGDYFLTGDRARKDEEGYFWFESRNDDI
IISSGYTIGPFEVEDALVKHPEVKECAVVASPDEIRGSIVKAYVVLQNHEKRSDELVKML
QNHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRRREEQLKANKKA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaacgtgaagatttaattgcccctatgcaatataatttagtgaatgaaatggaa
aagttcagtgccgctggacaaaaaaccgctcttctgtgggaggacgagtcgggcaagcaa
gaatcttggtcgtatgaaaagctgatggaagaaacaaataaaatcggagcggccttagct
gatcttggatttaaaaagggagacaagctgattgtaatggttccgcgggtgcttgaagcc
tatgctgtttatttggctatcctgaaatcaggaatggttgtcattccgtgctccgaaatg
cttcgcgcgaaagatcttgaataccggattgaacatgcagaggtaaaaggcgccatcgtc
tactcaaaatttattggcgctttccgggatgtcagtacggctgataaactgattacactg
tctattggtgaaaatgatgccggctggaaaaacctcttatcaattgaagcggacggaagc
caatttaaaacagctgacacaacaagagatgatatggctttcttatcttatacatccggg
acaacaggtcagccgaaaggtgttgtacatacacatggatgggcatttgctcatttaaaa
acttctgccggcgcttggcttgatatttctgaaaaggatatcgtctgggcaactgctgcc
cctggctggcaaaagtgggtatggagtccatttttagcggtgcttggcagcggagcaacc
ggttttgtgtaccacggcagattcaaagcagaaaaatatctagagcttttaaatcgctac
aaaatcaatgttttctgctgcacgccgacagaataccgcttaatggcgaaggttgaaggc
ttggaccgctttgatctttctgccctgcacagcgctgtttccgcaggtgagccgctcaac
cgtgaagtcattgatgttttccaaaagcactttggcattaaggtacgggacggatatggc
caaacagaaagcacgcttttggttggtgttttgaaggatacgcctattaaaccgggaagc
atgggaaaaccaacaccgggaaatcaggtggagatcataaatgaagacggtgaaatctgc
aaacctggtgaggttggcgatatcgctgttcacctcagtacgcctgcgctctttaaagag
tattttaaagatccggaaagaatgaaaacacaaattcgcggcgattatttcctaacggga
gacagagcaagaaaagatgaggaaggttacttctggtttgaaagccgaaatgacgatatt
attatcagctccggctatacgatcgggcctttcgaggtggaagacgcgcttgttaagcac
ccagaagtaaaagaatgtgctgttgtcgcaagccctgatgaaatcagaggctccatcgta
aaggcgtatgtagtcctgcaaaatcatgaaaaacgcagtgatgagcttgtcaaaatgctg
caaaaccatgtgaagacgattaccgctccatacaaatatcctagagaaattgaatttgtg
gaaagcctgccgaaaacggcttctgcaaaaataagacgagtggaattaagaagacgtgaa
gaacagctcaaagccaataaaaaggcgtaa

DBGET integrated database retrieval system