KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_17250Help
Entry
I653_17250        CDS       T02520                                 

Definition
(GenBank) anti-sigma factor repressor of sigma(D)-dependent transcription
  KO
K02398  negative regulator of flagellin synthesis FlgM
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy02020  Two-component system
bsy02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I653_17250
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    I653_17250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsy02035]
    I653_17250
Bacterial motility proteins [BR:bsy02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    I653_17250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgM Mt_ATP-synt_D
Motif
Other DBs
NCBI-ProteinID: AGI30686
LinkDB All DBs
Position
complement(3424328..3424594)
Genome map
AA seq 88 aa AA seqDB search
MKINQFGTQSVNPYQKNYDKQAVQKTAAQPQDKIEISSQAKEMQHASDAVAGSRQEKIAQ
LKAQIENGSYKVDANHIAKNMINFYKKQ
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaatcaatttggaacacaatccgttaatccatatcaaaaaaattatgataag
caagcggtgcaaaaaactgctgcacagcctcaagataaaattgaaatttcatcacaggct
aaagaaatgcaacatgcatccgacgcagtcgctggttcacgacaggaaaaaattgcgcag
cttaaagcgcaaattgaaaacgggtcatacaaagtagacgcaaatcatatcgcgaaaaat
atgattaatttttataaaaagcaataa

DBGET integrated database retrieval system