KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_19985Help
Entry
I653_19985        CDS       T02520                                 

Definition
(GenBank) putative acetyltransferase
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_10 Acetyltransf_1 Acetyltransf_7 FR47 Acetyltransf_5 Acetyltransf_9
Motif
Other DBs
NCBI-ProteinID: AGI31229
LinkDB All DBs
Position
3984310..3984753
Genome map
AA seq 147 aa AA seqDB search
MNVKKITSEQDLHTAFEIRKAVFVEEQGCPISDEFDEFDTLHGDCQHILAYHQSVPVGTA
RVRIVGHAGKLERICILKPYRKFGLGKIIVDALERIVKEQGISAFKLHGQTQAAGFYEKL
GYQTASEEFMLDGIPHVLMTKQDDSAL
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcaaaaaaatcacgtcagaacaggatttacatacagcgtttgaaatcagaaag
gcagtatttgtagaggaacaaggctgtcccatttcggatgaattcgatgagttcgataca
ctccacggtgattgccagcacatcttggcttatcatcagagtgtacctgttggcactgca
cgtgtccgtatcgttggccacgcggggaaactggaacgaatctgcattctgaagccttac
cgcaaattcggtctgggaaaaataatcgtcgatgcattagaacgtattgtgaaagaacaa
ggcatttctgccttcaaattgcacggccagacacaggcggcaggcttttatgaaaagcta
ggctatcagactgcatcagaagaatttatgctggatggcattccgcatgtgctgatgaca
aaacaagacgattctgcgctatag

DBGET integrated database retrieval system