KEGG   Brucella suis bv. 3: DK67_2036Help
Entry
DK67_2036         CDS       T03266                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bsz  Brucella suis bv. 3
Pathway
bsz00010  Glycolysis / Gluconeogenesis
bsz00620  Pyruvate metabolism
bsz01100  Metabolic pathways
bsz01110  Biosynthesis of secondary metabolites
bsz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DK67_2036 (acoD)
   00620 Pyruvate metabolism
    DK67_2036 (acoD)
Enzymes [BR:bsz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     DK67_2036 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIJ71410
LinkDB All DBs
Position
1:complement(2104807..2106324)
Genome map
AA seq 505 aa AA seqDB search
MNKVEFSRTVKPAFAKRYGNFIGGKWVEPRSGRYFENTSPVNGQVLCEVARSDAADVEAA
LDAAHAARELWGRTSVAERALILNRIADRIEENLPALAAAETWDNGKPIRETTNADLPLA
VDHFRYFAGVIRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALAA
GNCVVLKPAEQTPASILVLMELIADILPPGVVNIVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVAAEDDDFLDKAIEGFVMFALNQGEVC
TCPSRALIQESIYDRFMKKALKRVEAIVQGDPLDPATMIGAQASSEQLEKILSYLDIGRQ
EGAEVLAGGERNMLPGDLAGGYYVKPTVFKGHNKMRIFQEEIFGPVVSVATFKDDAEALS
IANDTLYGLGAGIWTRDGTRAYRFGRAIKAGRVWTNCYHAYPAHAAFGGYKQSGIGRENH
LKMLDHYQNTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggttgaattcagccggaccgtgaaaccggcttttgcaaaacgctatggcaat
ttcatcggcggcaaatgggtggaacccaggtcaggccgctattttgagaatacatcgccc
gtaaacggccaggttctgtgtgaagtggcccgttccgatgctgccgatgtggaagcggcg
ctcgatgcagcgcacgccgccagggagctatggggcaggacaagcgtggctgaacgcgcg
cttatcctcaatcgcatcgcagaccggattgaggaaaacctgcctgcattggcggctgcc
gaaacatgggacaacggcaagccgatccgcgaaaccaccaatgccgacctgccgctggcg
gttgatcatttccgctatttcgcgggcgtcatccgcgctcaggaaggcggtatttctgaa
atcgatcacgatacggtcgcctatcacttccacgaaccgctgggcgtggtggggcagatc
attccgtggaacttcccgcttctcatggcgacatggaagcttgcgccagcccttgccgca
ggcaattgcgtggtgctgaaacccgccgaacaaactccggcttccatcctcgtgctgatg
gagctcattgccgatattctgccgccgggtgtggtcaatatcgtcaatggtttcggcctt
gaggccggtaagccgctggcatccagcccccgcatcgccaagatcgccttcacgggtgag
acgacgaccggccgcctcatcatgcaatatgccagccagaacctcatcccggtcacgctg
gagctgggcggcaagtcacccaacatcttcttcaaggatgtcgcggctgaagatgatgat
tttctggacaaggccattgaaggcttcgtgatgttcgcgctcaatcagggcgaggtctgt
acttgccccagccgcgcgctcattcaggaatcgatctatgacaggttcatgaaaaaggcg
ctgaagcgtgttgaagccatcgtgcagggcgatccgcttgacccggccacgatgattggc
gcgcaggcatcgagcgaacaactcgaaaaaatcctgagctatctcgatattggccgtcag
gaaggtgcggaagtgctggcaggtggcgaacgcaacatgctgccgggcgatcttgctggc
ggctattatgtgaagccgaccgtcttcaagggccataacaagatgcgcattttccaggag
gaaatcttcgggccggtcgtgtccgtcgcaaccttcaaggatgatgcggaggcgctatcg
attgccaatgacacactctatggcctcggtgcgggcatatggacgcgcgatggcacacgc
gcctatcgcttcggtcgcgccattaaggcaggccgcgtctggaccaactgctaccacgcc
tacccggcccatgcggctttcggtggttacaagcagtcggggatcgggcgcgagaaccat
ctgaagatgctcgatcactaccagaataccaagaacatgctggtgagctacagcccgaag
aagcttggcttcttctaa

DBGET integrated database retrieval system