KEGG   Bos taurus (cow): 100296901Help
Entry
100296901         CDS       T01008                                 

Definition
(RefSeq) probable maltase-glucoamylase 2 isoform X1
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
bta  Bos taurus (cow)
Pathway
bta00052  Galactose metabolism
bta00500  Starch and sucrose metabolism
bta01100  Metabolic pathways
bta04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100296901
   00500 Starch and sucrose metabolism
    100296901
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100296901
Enzymes [BR:bta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100296901
    3.2.1.20  alpha-glucosidase
     100296901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100296901
NCBI-ProteinID: XP_010802921
LinkDB All DBs
Position
4
AA seq 2717 aa AA seqDB search
MARKLSALEILLIIFIIIVLAVDILFLMLLLEKPSGASFVPECPEIPESERIDCAPGQEV
TEDVCRQRYKCCWKPVPDTAIPWCFFPRNWGYEISNLVKNTSTEYEAQLRRLPSPSLFGY
DVIDTLFRAEYQTSNRFHFKITDFNNMRYEVPHENVKLFDGNADASNLSYHLEVIHKPFS
IKIMRASNKRVLLDTSIGPLQFAQQYLQLSMRLPSANVYGLGEHVHQQYRHNMTWKTWPI
FTRDATPTEGMINLYGAHTFFLCLEDTSGFSFGVFLMNSNAMEVTLQPAPAVTYRTIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFLPPYWSLGFQLSRRNYGGIDGLKNVVNRTREAEI
PYDVQYSDIDYMDEKKDFTIDGVAFRGLSGFAEELHKNGLKYVIIMNPGILNNSDYQPYA
NGSRKRVWILGDKGFVVGQAYPGWTVFPDFTNPDCTEWWKEQFSEFYKTLEFDGVWIEMD
EVSSFLQSSDQDCEVNNFNFPPFKPRVLDHLLFARTLCMDTEFHGGFHYDVHSLYGYTMA
KATDSAMENIFRNKRRFILSRSTFAGSGKFAAHWLGDNAARWDDLRWSIPGILEFNLFGI
PMVGANICGYRENVTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFSENNAMLLESSR
YYLNIRYTLLPYLYTLFYRAHTLGETVARPLVHEFYQDPATWEVHEQFLWGPGLLITPVL
YEGLNYARAYIPDAIWYDYETQVAIEWRKQFVEMLLPGDRIGLHLRGGYIFPIQQPNTTT
ETSRKNSLGLIIALDSKREAKGELYWDDGVSKDAVTGNNYILYKFSITSNRLQATIIHAN
YTDPDKLTFTDIMILGMDKEPTNFTVSLNDVTTSISNVVYTESTKVVNITDLEGLVLGQA
FSIQWDLPVSDLQKFNCFPEQPAVSEESCRERGCLWEPTTVPGVPTCFYDTIPNYAASNI
QYLPTGITVDLTHLTASEAGQAMVPAPSSQDKLSPPAAAAKAASASDTLSATIGFLRLSV
TYHTENMLQFKIYDPTNKRYEVPVPLNTPSSPVGSPENCLYDVKIQNNPFGIQIRRKSSS
TVIWDSQLPGFTFRDMFLSISTRLPSQYLYGFGETEHTTFRRNISWHTWGMFARDEPPAY
KKNSYGVHPYYMALEEDGSAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMVLGPTP
ELVTQQYTELIGRPAMIPYWALGFQLSRYGYQDDYEISSLYVAMMAAQIPYDVQHVDIDY
MDRKLDFTLSPSFQNLGPLIEQMKKNGTRFVLVLDPAISGNETQYLTFTRGKESDVFIKW
PDNSDIVWGKVWPDLPNVNVDGSLDHETQVKLYKAHVAFPDFLRNSTAAWWKREIEELYR
NPREPEKSLKFDGLWINMNEPSNFVNGSVRGCSDEILNNPPYVPYLESRDRGLSSRTLCM
ESQQVLPDGSPVRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWL
GDNRAAWDQLKKSIIGMMEFSLFGISYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNH
NTFGTRRQDPVAWDSAFEMFSRKVLQTRYTLLPYLYTLMHKAHAEGSTVVRPLLHEFTEE
RTTWDIDHQFMLGPAVLISPVLENNTFQVQAYFPRARWYDYSTGSGNESTGEWKVLEAPL
DHINLHIRGGYILPWQEPAMNTYSSRQKYMGLIVALDDNGRAEGQLFWDDGQSIDTFENG
NYFLVNFTAAQSVLQIQMIHNNYLSDTNSLKVGYIRIWGINSTDITQVTVSYDNQQFMVM
NFKSDPYNQTLNIQLTDKIISLEKLTEITWIHSGPIVSTTTMTSTFPMSSLHPPTTSTTA
ATSVTTSSSTPSSTSTTDSSSAALPMTTTSFPTSATEVSTGTTVPNTSTSFPTNTATDST
SVILPITTMHYPTSATEVSTSVTVPNTTISSPIHTTLDSTDSTLPITDTPYTTSATQVLT
STTVPNATVSSPINTTTDTTDITLTITDTPSTTSATQVSTSTTVPNATISSPINTTTHST
NVTLPVTTTPYITTTAEVSTSTTVPNATISSPINTTTDNTNVTLPVTTMSYITTTAEVST
STTVPNATVSSPINTTADSTNVTLPVTTMAYTTSTAEVSTTTTFLNATISSPIYTTLDST
NVTLHITDTPYTTSATQVSTSTTVPNATISSPINTTTDSTILTLSVTTMLYPTSATEVST
STTFPNATISSPINTTTDTTDITLPITDTPYTTSATQVSTSTTVPNATISSPINTTTDGT
NVTLPVTDMLYTTSASQVSTSTTVPDATISSPINTTTDTTDITLPITDTPYTTTASQVST
STTVPNATISSPINTTTDTTDITLPITDTPYTTTASQVSTSTTVPNATISSPINTTTGTT
DITFPITDTPYTTTASQVSTSTTVPNATISSPINTTTDTTDITLPITDTPSTTTASQVST
STTVHNATISSPINTTTDTTDITLPITDTPSTTTASQVSTSTTVPNATISSPINTTTGTT
DITFPITDTPYTTTASQVSTSTTVPNATISSPINTTTDTTDITLPITDTPSTTSATQVST
STTVPNATISSPINTTTDSTNVTLPVTTMPYTTSTAEVSTTTTFPNATISSPINASMDST
DITLPITDTPYTSATQVSASTTASNNTTISSTINTTIDSTNVTLPVTTMPFPKSSTEVST
STAVSNTTVSSPTNSTV
NT seq 8154 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagcttagtgcattggaaatcctcctgatcatcttcatcataattgtactt
gctgtagatatcctctttctgatgcttctgttggagaagccttcaggtgcttcatttgtt
ccagagtgcccagaaatccccgaatcagaaaggatagactgtgcccctggccaggaggtg
acagaggatgtctgccgacagagatataagtgctgctggaaacctgtgccagatactgcc
atcccctggtgcttcttccccaggaactggggctacgaaatcagcaatttggttaaaaat
acaagcacagagtatgaggcccagttgagaaggctgccatcaccatctctgtttggatat
gatgtaatcgacaccctcttcagagctgaatatcagacatccaatcgtttccattttaag
atcactgatttcaataacatgcgctatgaagtcccccatgaaaatgttaagctctttgat
gggaatgctgatgcttccaatttgagctatcatctagaagtcattcacaaacccttcagc
atcaagataatgagggccagcaacaaaagagtcttgttggacaccagcattgggcccctc
cagtttgcccagcagtacctgcagctctccatgcgactgcccagtgccaatgtgtacggg
ctgggcgaacacgtgcaccagcagtaccgccacaacatgacctggaagacctggcccatc
ttcacccgggacgccacccctaccgagggcatgattaatctatatggagctcacacattc
ttcttgtgcctagaagacaccagcggcttctctttcggggtttttctgatgaacagtaac
gccatggaggtcacccttcagcccgctcctgccgtcacttaccgcacgatcgggggtatt
cttgacttctatgtgttcctgggaaatactccagaacaagtggttcaggaatatctggag
cttgttggacgaccattcttgcctccctactggagtcttgggttccagcttagtcgcagg
aattatggtggtattgatggattgaaaaatgttgtaaaccgaactcgtgaagctgagatc
ccttatgatgtccagtactctgacatagactacatggatgaaaagaaggatttcactatt
gatggagtggccttccgtggtctctcaggttttgccgaagagttacataaaaatggactg
aaatatgtaattattatgaatcctggcatcttaaataactctgactaccagccttatgcg
aatggaagcagaaagagagtgtggatcttgggggacaaaggctttgttgttgggcaggca
tatcctggctggacagtttttcctgattttactaatccagattgtactgagtggtggaaa
gagcagttcagtgaattttataaaactctggagtttgatggagtgtggattgaaatggat
gaagtatctagctttctacaaagttctgatcaagactgtgaagtaaacaacttcaacttt
cctcctttcaaacctcgagttctggatcacttgcttttcgcaagaaccctctgcatggac
acagagtttcatgggggctttcactacgatgtccacagcttgtatggctacaccatggca
aaagccacagactcggccatggagaatatcttccgcaataagagacgcttcatcttatca
cgttctacttttgcgggatctggcaaatttgctgctcattggttgggggacaatgcagcc
agatgggacgatctccgatggtccatccctggtatcctggagttcaacctattcggcatc
cccatggtaggtgccaacatctgtggttacagagagaatgtcacagaggagctttgcaga
cggtggatgcagctgggagcattttatccactgtcgaggaatcacaacgggcctgggttc
agggaccaggatcctgctgccttcagtgaaaacaacgctatgctgttggaatcctccaga
tactatctgaacatccgctacaccctgctgccctatctctacacccttttctaccgagct
cataccctgggggagaccgtagcaaggcccctcgtccacgagttctaccaggacccagcc
acctgggaggtgcacgagcagttcctctgggggcctggactcctcatcacgcctgtttta
tatgaaggtttgaactatgcaagagcatacatacccgacgccatctggtacgactatgaa
acgcaagtagctatagaatggaggaaacaatttgtggagatgctgctgccaggtgatagg
ataggacttcacctccgagggggctacatctttcccatccagcagccaaacacgaccaca
gagaccagccggaagaactctctgggactcatcattgccttggactctaagcgagaagca
aagggagagctgtactgggatgatggtgtctctaaagatgctgtaactggaaataattat
attctgtataagttttccatcacctctaaccgtctacaggcaacgattatacatgctaat
tatacagaccctgacaaactcacatttacagatatcatgatcttgggaatggacaaggaa
cctactaattttactgtctccctaaatgatgtgaccacctccatttcaaatgttgtctac
acagaatcaacaaaggtggtgaacatcactgaccttgagggactggtactgggacaagca
ttctccattcagtgggatcttccagtcagtgacctgcagaagttcaactgctttcctgag
cagcctgctgtctccgaggagagttgcagggagcgggggtgcctttgggagccaacgact
gttcctggggtgcccacctgtttctatgacaccatccctaattatgctgccagcaacatt
cagtacctgcctacgggcatcactgtagacctcacccacctgacagcctcagaagctgga
caagctatggtgccagcaccatcatcacaggacaagctatccccacctgcagccgcagcg
aaggccgcctctgcctctgacactctctctgcaaccatcggctttctccgcctgagcgtg
acctaccacacagagaacatgctgcagttcaagatctatgatcccactaataaaaggtac
gaggtcccagtgcctctgaacaccccttcgtctccagtgggctcccctgaaaactgtctg
tatgatgtcaagattcagaacaatccttttgggatccagattcgaagaaagagctccagc
actgtgatttgggactctcagctccctggcttcaccttcagggacatgttcctttccatc
tccacacgcctcccctctcagtacctctatggctttggggaaactgagcacacaactttc
agaagaaacataagctggcacacgtggggaatgtttgcccgagatgagccaccagcgtat
aagaagaactcctatggtgtccacccctactatatggcactggaggaggatggcagtgcc
catggagtgctcctgctgaacagcaatgccatggatgtgacattccagcctactcctgcc
ctgacataccgcaccacaggaggcattttggacttttatatggttttggggccaacccct
gagcttgtaactcaacaatacactgagttgattggtcggccagcaatgattccttactgg
gccttgggattccaactgagtcgctatggataccaggatgattatgaaatctccagtttg
tatgttgcaatgatggctgctcagattccctacgatgtccagcatgtcgacatcgactac
atggaccggaagctggacttcactctcagccccagctttcaaaatcttggccccctgatt
gagcaaatgaagaaaaatggcacaagatttgttcttgttctggacccagccatttctggc
aatgagacccagtatctcacattcaccagagggaaggaaagtgatgtgttcatcaaatgg
ccagacaacagcgatattgtctggggaaaggtttggccagatctgcccaacgtgaatgtg
gatgggtcccttgatcacgaaactcaggttaagttgtacaaagcccacgttgcttttcct
gacttcttgcggaacagcactgctgcctggtggaagagggaaatagaagagctctacaga
aaccctcgagagccagagaagagcttgaagtttgatggattgtggattaacatgaatgaa
ccatcgaactttgtaaatggatctgtcaggggctgcagtgatgaaattcttaataatcca
ccctatgtgccatacttggagtcccgggaccggggcctgagcagcaggaccctgtgcatg
gagagccagcaggtgctgcccgatggctcaccggtgcgccactacgatgtgcacagcctt
tatggctgggcccagaccagacccacgtacgaagctgtgcaggaggtgacgggacagcga
gggatcgtcatcactcgctccactttcccctcttctggccgctggggaggacactggctg
ggtgacaacagggccgcgtgggaccagctgaagaagtcaatcattggcatgatggaattc
agtctctttggaatctcttatacaggagcagacatctgtggattctttggagatgctgag
tatgagatgtgtgttcgctggatgcagctgggggcgttttatccattttccaggaaccac
aacacattcgggaccaggagacaagatcctgtggcctgggactcagcctttgagatgttc
tcaagaaaagtcctccagaccagatatactctgctgccttacctctatactctgatgcat
aaggctcacgctgagggcagcactgtggtccgaccccttctccatgagtttacagaggag
cgcacaacatgggatatagaccatcagttcatgctgggccctgccgtcttaattagcccc
gtgctggaaaataacacttttcaggtccaggcttactttcccagagcccgttggtatgac
tacagcacgggatctggcaatgaatcaacaggtgagtggaaagtcctggaggctcccctg
gaccatatcaaccttcatatcagaggaggctacatcctgccttggcaagaacctgcgatg
aacacttactccagccgacagaaatatatgggattgattgttgctttggatgataatggg
agagctgaaggtcagctgttctgggatgatggacaaagcattgatacctttgaaaatgga
aactatttcttggtaaactttacagcagctcagagtgtactgcaaatccaaatgatacat
aataattatttgagtgacactaattcactgaaagttggatatattagaatctggggcata
aactctactgatataacacaagtgactgtctcctatgacaatcaacaattcatggtgatg
aatttcaagagtgacccttacaatcagacactaaatattcaactgactgacaagattatc
agcctggaaaagttaactgagattacttggattcacagtggtcctatagtttctactaca
actatgacgagtaccttcccaatgagttctttacatcctcctacaacttctactactgct
gctacttctgttaccactagttcttctactccaagtagcactagtactactgatagcagt
agtgctgctcttcctatgacaaccacttcttttccaacaagtgccactgaggtttcaact
ggtactaccgttcccaataccagtacatctttccctacaaatactgctactgatagcact
agtgttattcttcccatcacaaccatgcattacccgacaagtgctactgaagtttcaact
agtgttactgtccctaataccactatatcttcacctatacatacgactctggatagcact
gatagtactcttcctatcacagacacgccatacacaacaagtgctactcaagttttaact
agtactactgtccctaatgccactgtatcttcccctataaatactactactgataccact
gatattactcttactatcacagacacgccatccacaacaagtgctactcaagtttcaact
agtactactgtccctaatgccactatatcttcccctataaatactactactcatagcact
aatgttactcttccagtcacaaccacgccttacataacaactactgctgaagtttcaacc
agtactactgtccctaatgccactatatcttcccctataaatactactactgataacact
aatgttactcttccagtcacaaccatgtcttacataacaactactgctgaagtttcaact
agtactactgtccctaatgccactgtatcttcccctataaatactactgctgatagcact
aatgttactcttccagtcacaaccatggcttatacaacaagtactgctgaagtttcaact
actactactttccttaatgccactatatcttctcctatttatactactctggatagcact
aatgttactcttcatatcacggacaccccatacacaacaagtgctactcaagtttcaact
agtactactgtccctaatgccactatatcttcccctattaatactacgaccgatagcact
attcttactctttctgtcacaaccatgctttacccaacaagtgctactgaagtttcaact
agtactactttccctaatgccactatatcttcccctataaatactactactgataccact
gatattactcttcctatcacagacaccccatacacaacaagtgctactcaagtttcaact
agtactactgtccctaatgccactatatcttcccctataaatactactactgatggcact
aatgttactcttccagtcacagacatgctatacacaacaagtgcttctcaagtttcaaca
agtactactgtccctgatgccactatatcttcccctataaatactactactgataccact
gatattactcttcctatcacggacacgccatacacaacaactgcttctcaagtttcaaca
agtactactgtccctaatgccactatatcttcccctataaatactactactgataccact
gatattactcttcctatcacggacacgccatacacaacaactgcttctcaagtttcaaca
agtactactgtccctaatgccactatatcttcccctataaatactactactggtaccact
gatattacttttcctatcacagacacgccatacacaacaactgcttctcaagtttcaaca
agtactactgtccctaatgccactatatcttcccctataaatactactactgataccact
gatattactcttcctatcacggacacgccatccacaacaactgcttctcaagtttcaaca
agtactactgtccataatgccactatatcttcccctataaatactactactgataccact
gatattactcttcctatcacggacacgccatccacaacaactgcttctcaagtttcaaca
agtactactgtccctaatgccactatatcttcccctataaatactactactggtaccact
gatattacttttcctatcacggacacaccatacacaacaactgcttctcaagtttcaaca
agtactactgtccctaatgccactatatcttcccctataaatactactactgataccact
gatattactcttcctatcacagacacgccatccacaacaagtgctactcaagtttcaacg
agtactactgtccctaatgccactatatcttcccctataaatactactactgatagcact
aatgttactcttccagtcacaaccatgccttatacaacaagtactgctgaagtttcaact
actactactttccctaatgccactatatcttcccctataaatgcttctatggatagcact
gatatcactcttcctatcacagacacgccatacacaagtgctactcaagtttcagctagt
actaccgcctctaataataccactatatcttccactataaatactactattgatagcact
aatgttactcttccggtcacaaccatgcctttcccaaaaagtagtactgaagtttcaact
agtactgctgtctctaatactactgtatcttcccctacaaacagtactgtctag

DBGET integrated database retrieval system