KEGG   Bos taurus (cow): 100299249
Entry
100299249         CDS       T01008                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
bta  Bos taurus (cow)
Pathway
bta04060  Cytokine-cytokine receptor interaction
bta04151  PI3K-Akt signaling pathway
bta04210  Apoptosis
bta04630  JAK-STAT signaling pathway
bta04640  Hematopoietic cell lineage
bta05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100299249 (IL3RA)
   04151 PI3K-Akt signaling pathway
    100299249 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100299249 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100299249 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100299249 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100299249 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bta04050]
    100299249 (IL3RA)
   04090 CD molecules [BR:bta04090]
    100299249 (IL3RA)
Cytokine receptors [BR:bta04050]
 Interleukin receptor families
  IL3 receptor family
   100299249 (IL3RA)
CD molecules [BR:bta04090]
 Proteins
  100299249 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind TAP35_44
Other DBs
NCBI-GeneID: 100299249
NCBI-ProteinID: XP_024846068
LinkDB
Position
3
AA seq 379 aa
MALPWLAVLLTLICCSMTTDHAISDPDPPIKNLRIDPERKRLAWDQHGNVSEIGCYVNSK
ILKKAIEKPYCSLGDLSCEVKNYTVKVIKGQPFSAWIQYPKQGNPLAAADNLTCRVHDVD
QLSCSWAVGEEAPANVQYHFYLKHPLKTWPCPKYMQNQQGVNVQCHFDSLSLQPERQTLF
RFLVNGTSGGSKIPCRQMTHRLEEIEILAAPNITKKWCNESYSFMEWEVRSLFTEDIKYE
LEIQKGTDLAYKEETELKVLGLRNPGPYTVKIKAMDSLFFESRPAGQWSAPQHLDCGRKD
ASFPIWLVYLLAPLGALLLVGLVFLCRRWPLMQKLFPRVPHVKDPVGDSFQNERMMAWDP
EQQSQEECPVVRVQVLGET
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggccctcccctggctggccgtgctcctgacactcatctgctgctcgatgaccacggac
cacgccatctctgatccagacccaccgattaagaacttaaggatagatccagaaagaaaa
agattggcctgggaccagcacggaaatgtttctgaaattgggtgttacgtcaattcgaaa
attttaaaaaaggcaatagagaagccctattgcagtcttggcgacttgtcgtgcgaagtg
aaaaactatactgtgaaggtgataaaaggtcaaccgttctctgcttggattcagtatcca
aagcaaggcaaccccctggcggccgcggacaacctgacctgccgggtgcacgacgtggat
cagctcagctgcagctgggcggtgggcgaggaggccccggcgaacgttcaataccatttc
tatctgaagcaccccttgaagacgtggccatgtcccaagtacatgcagaaccagcagggc
gtcaacgtccagtgccattttgacagcctctcccttcaacctgaacgccaaactctgttc
cgtttcctggtgaatggtaccagcggtggctccaaaatcccctgccgccaaatgacccat
agattggaagaaattgaaatattagctgccccgaacatcacaaaaaagtggtgtaacgaa
agctactcattcatggaatgggaagtaaggagtctctttactgaagacatcaagtatgaa
cttgagatacagaagggcacggaccttgcctacaaagaggagacagagctcaaggttttg
gggctgaggaatccgggaccctacacagtgaagatcaaggccatggactccctgttcttc
gagagcagaccggcaggccagtggagcgccccgcagcacctcgactgcggccgcaaggac
gcgtccttcccgatctggctggtatacctgctggccccgctcggggcgctgctcctggtg
gggctcgtcttcctgtgtcgcaggtggccgttgatgcagaagctcttcccgcgtgtccct
cacgtgaaagaccccgtcggcgacagctttcagaacgagaggatgatggcctgggacccc
gagcagcagagccaggaggagtgcccggtggtccgcgtgcaggtgttgggggaaacgtga

DBGET integrated database retrieval system