KEGG   Bos taurus (cow): 100336421Help
Entry
100336421         CDS       T01008                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase, intestinal isoform X2
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
bta  Bos taurus (cow)
Pathway
bta00052  Galactose metabolism
bta00500  Starch and sucrose metabolism
bta01100  Metabolic pathways
bta04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100336421 (MGAM)
   00500 Starch and sucrose metabolism
    100336421 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100336421 (MGAM)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100336421 (MGAM)
    3.2.1.20  alpha-glucosidase
     100336421 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100336421
NCBI-ProteinID: XP_005205978
Ensembl: ENSBTAG00000046152
VGNC: 31446
LinkDB All DBs
Position
4
AA seq 1831 aa AA seqDB search
MARKKLKKFTTLELMLSILLLVVFIITIPIFVLSARDSLESQDPGTTVSPDSGTSTTPGS
AECPVVNDSERINCIPDQSPTKATCDQRGCCWSPQGTISMPWCYYSKSHGYQVGGDLVNT
NAGFTAQLKRLSSPLFGNDVNNVLLTAEYQTSNRFHFKLTDQNQNRYEVPHEHVQPFTGN
AASSLTYKVEVSKQPFGIKVIRTSNNRVLFDSSIGPLLFAHQFLQLSIRLPSANVYGLGE
HVHQQYRHDMNWKTWPIFARDTTPNGDGTNLYGAQTFFLCLEDASGLSFGVFLLNSNAME
VFLQPTPAVTYRTIGGILDFYVFLGNTPEQVVQEYLELVGRPALPSYWALGFHLSRYDYG
TLDNMKEVVERNRAAQLPYDVQHADIDYMDARKDFTYDPVAFKGFPEFVKELHNNGQKLV
IIVDPAISNNSSLSNPYGPYDRGSDMKIWVNTSDGVTPLIGEVWPGKTVFPDYTNPKCTA
WWTNEFELFHSQVEFDGIWIDMNEVANFVDGSVSGCSTSNLNYPPFTPKILDGYLFSKSI
CMDAVQHWGQHYDVHNLYGYSMAITTAETVKTVFPNKRSLILTRSTFAGSGKFAAHWLGD
NAATWSDLRWSIPGMLEFNLFGIPMVGADICGFMLDTSEELCRRWMQLGAFYPFSRNHNG
QGYKAQDPASFGPDSLLLNSSRHYLTIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYQD
SNTWDVHQQFLWGPGLLITPVLDEGAEKVTAYMPDAVWYDYETGGRVRWRKQKVEMELPG
DKIGLHLRGGYIFPTQQPATTTVASRRNPLGLIIALDENKEAKGELFWDDGETKDTVANN
LYLLCEFSVTQNRLEVKILQSTYTDPNNLAFKEIKILGTQEPNKVTVKQNGVPIQVSPNV
TYDSNLQVALITEIDLVLGGTYTVEWDVKIRDEEKIDCYPDETGVSAENCTARGCAWEES
SSHGVPFCYFVNDLYSVSDVQYDSHGASAVITLKTSLYAHSFPSVPVNSLRLTVTYHKDN
MLQFKIYDPSNNRYEVPVPLNIPSIPSGTSESQLYAVLIKKNPFGIEIRRKSTGTVIWDS
QLLGFTFNDMFIRISTRLPSKYLYGFGETEHTAFRRDLEWNTWGMFSRDQPPGYKKNSYG
VHPYYMALEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGILDFYVVLGPTPELVTQQ
YTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDAMVAAQIPYDVQYSDIDYMERQLD
FTLDAEFEGFPALITRMRADGMRVIIILDPAISGNETKPYLPFTRGVEDDVFIKDPSDGS
IVWGKVWPDFPDVVINSSLDWDSQVEKYRAFVAFPDFFRNSTTTWWKRELRELYTNPREP
EKSLKFDGLWIDMNEPASFVNGAVPPGCKDATLNHPPYMPYLESRDRGLSSKTLCMESQQ
VLPDGSPVRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDNT
AAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCARWMQLGAFYPFARNHNTIG
TKRQDPVSWNSTFVTISKSVLETRYTLLPYIYTLMHKASTEGSTVVRPLLHEFVSDRVTW
DVDSQFLLGPAFLVSPVLEANARDVTAYFPRARWYDYYTGVDIQSRGEWKSLPAPLDHIN
LHVRGGYVLPWQEPAQNTHLSRQKFLGFKVALDDEGAAEGWLFWDDGQSIDTYEKGLYYL
AHFSVSQNMMHSHIIFNNYISNTNPLRLGYFEVWGVGSDSISSVSISASGVVITPTFSYN
STTQVLNIDVTSRNISLHNFTSLMWRSTPNF
NT seq 5496 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgaaaaagttcactactttggagctcatgctcagtattcttctg
cttgtggtgtttatcatcactattcccatcttcgtgctttcagccagagattccctggaa
tcacaagatcctgggacgacagttagcccagattctgggacaagtaccacccctggttct
gctgagtgcccagtggtaaatgactctgaacggataaactgcatccctgaccaatcacca
acaaaggctacctgtgaccagcgtggctgttgctggagtcctcagggaaccataagtatg
ccctggtgctactattctaaaagtcatggctatcaagtagggggcgacctcgtgaacaca
aatgcaggattcacagcccagctgaaaaggttgtcttcacctctgtttggaaatgatgtc
aacaatgtccttctcacagcagaataccagacatctaaccgtttccattttaagttaact
gaccaaaaccagaacagatacgaagtgccccatgaacatgtgcaacccttcacaggaaat
gctgcctcttccttgacgtataaagttgaggtctccaaacagccatttggcatcaaagtg
atcagaacgagcaacaatcgtgttctgtttgactccagcatcgggcccctgctgtttgct
caccagttcctgcagctctccatccgactgcctagtgccaacgtgtatgggctgggagaa
cacgtgcaccagcagtaccggcatgacatgaactggaagacctggcccatatttgccagg
gacacaacccccaatggggatggaactaacttgtatggtgcacagacgttcttcctatgc
cttgaagatgctagtggattgtcctttggagtgtttctgctgaacagcaatgccatggag
gttttcctccagcccaccccagctgtcacttaccgcaccattgggggcattcttgacttc
tacgtgttcttggggaatactccagagcaagttgttcaagaatatctagagctcgttgga
cggccagccctaccctcatactgggctcttgggtttcatctcagtcgttatgactatgga
accctagataacatgaaagaagtcgtggagagaaaccgtgctgcgcagctgccttatgat
gttcagcatgctgatattgattacatggacgcaagaaaggacttcacttatgatccagta
gctttcaagggcttccctgagtttgttaaagaattacacaataatggacagaaactggtc
atcattgtggatcctgccatctccaacaactcttccctaagtaatccctatggcccgtat
gaccggggttcagatatgaagatatgggtgaatacttcagacggggtgactccactcatt
ggggaggtctggcctggaaaaactgtgtttcctgattacaccaaccctaagtgtactgct
tggtggacaaatgaatttgagcttttccacagtcaagtagagtttgatggaatctggatt
gatatgaatgaagttgccaactttgtggatggctcagtttcaggatgttccacgagcaat
ctaaattatcccccattcactcccaaaatcctggatgggtacctgttcagcaagagcatc
tgcatggacgcagtgcagcactgggggcagcattacgatgtccacaatctgtacggctac
tccatggccatcaccactgcagaaactgtcaagactgtgttccccaacaagagaagcctc
attttaacccgttctacgtttgcgggttctggcaagtttgcagcccactggctaggagac
aatgccgccacctggagcgaccttcgatggtccatccctggcatgcttgagttcaacctg
tttggtatccccatggtgggcgctgacatatgtggctttatgctggatacttctgaagag
ctctgcagacggtggatgcagctgggagcgttctatccattttccaggaatcacaatggc
caaggctacaaggcccaggatccagcctcctttggccctgactcactgctgttgaattcc
tccaggcactacctgaccatccgctatacccttctgccctatctctacacactcttctac
cgtgctcacagccgcggggacactgtggccaggccccttctgcatgagttctaccaggac
agcaacacctgggatgtgcaccagcagtttttatgggggccgggcctcctcatcactcca
gtcctggatgagggtgcagagaaagtgaccgcatacatgcctgacgctgtctggtatgac
tatgagactgggggccgagtgagatggaggaagcaaaaagtggagatggaacttcctgga
gacaaaattggacttcacctgcgaggaggctacatcttccccacgcagcagccagccacg
accacggtggccagtcgacggaaccctctcggtctaatcattgccctggatgagaacaaa
gaagcaaaaggagaacttttctgggatgatggggaaacaaaagatactgtggccaacaac
ctttatctcttatgtgagttctccgtcacccaaaaccgcctggaggttaagattctgcaa
tcaacctacacagaccccaataatttagcatttaaagaaattaaaatccttggaacccag
gagcctaacaaggttacagtgaaacagaacggtgttccaattcaagtttctcctaatgtc
acttacgattccaacctacaggtggcccttatcacagaaattgatcttgttctgggagga
acatacacggtggagtgggatgtgaagataagggatgaagaaaaaatagactgttatcct
gatgagactggtgtttctgcagaaaactgcactgcccgcggttgtgcctgggaggagtcc
agttctcatggagtccctttttgctatttcgtcaatgatctctactctgtcagtgatgtt
cagtatgactcacatggggcctcagctgtcatcaccttaaagacttctctgtatgcccac
tccttcccctcagtaccagtgaactccctgcgcctgactgtgacctaccataaggataac
atgctgcagtttaagatttatgatcccagcaacaaccggtatgaagttccagtccctctc
aacatacccagcattccatctggcacctctgagagtcaactctatgctgtcctcattaag
aagaatccatttgggattgaaattcgccgcaagagtacaggcactgtcatctgggactct
cagctcctcggctttaccttcaatgacatgttcatccgcatctccacgcgcctcccctcc
aagtacctctatggctttggggaaactgagcacacagccttccgaagagacctggaatgg
aacacgtgggggatgttctcccgagaccaacccccggggtacaagaagaactcctatggt
gtccacccctactacatggcactggaggaggatggcagcgcccacggagtgctcctgctg
aacagcaatgccatggatgtgaccttccagcccttgcctgccttgacataccgtaccaca
ggaggaattctggacttttatgtggttttagggccaactccagagcttgtcactcagcag
tacactgagttgatcggtcggccagtgatggttccttactggtccctggggtttcagctg
tgtcgctatggataccagaacgactctgagatcgccagcttgtacgatgctatggtggct
gcacagatcccctatgatgtgcagtattcggacattgactacatggagcggcagctggac
ttcacccttgatgccgagtttgaggggtttccagctctgattactcgcatgagggccgat
gggatgcgagtcattatcattctggacccagccatttctggcaacgagaccaagccctat
ctgccattcacacggggtgtagaggatgatgtcttcatcaaagatccgagtgatgggagc
attgtctggggaaaggtctggcctgattttcctgatgtggtaataaacagttctctagac
tgggacagtcaagtggagaaataccgggcatttgtggcctttccagactttttccgtaat
tcaaccaccacatggtggaagagggagttgagagaactgtacaccaatccacgggaacca
gagaagagcttgaagttcgatggcttgtggattgatatgaatgaaccagcgagcttcgtg
aatggagcagtccctccaggctgcaaggatgccactctgaaccaccctccctatatgcca
tatctggagtccagggaccggggcctgagcagcaagaccctgtgcatggagagccagcag
gtcctgcctgacggctcaccggtgcgccactacgacgtgcacagcctctacgggtgggcc
cagaccagacccacatacgaagctgtgcaggaggtgacgggacagcgagggatcgtcatc
actcgctccactttcccctcttctggccgctggggaggacactggctgggtgacaacacg
gctgcatgggaccagctgaagaagtcaatcattggcatgatggagtttagtctctttggt
atatcctacacaggagcagatatttgtggattctttcaagatgctgaatatgaaatgtgt
gctcgctggatgcaactaggggccttctaccccttcgcaaggaatcacaataccattggg
accaagaggcaagaccccgtgtcctggaattctactttcgtgacaatctccaagagtgtc
ctggagaccagatacaccctgttgccgtatatctacaccctgatgcacaaggccagcaca
gagggcagcaccgtcgtgcggcctctcctccatgagtttgtgtcagaccgggtgacctgg
gatgtagacagtcagttcctgctgggcccagccttcctggtcagccctgtcctggaggct
aacgccagagatgtcactgcatatttccctagagcccgctggtatgattactacacgggt
gtggacattcaatcccggggtgagtggaagtccttgccggcacctcttgaccacattaat
cttcatgtccgtgggggctatgtcctgccctggcaagagcctgcacagaacacccactta
agccgtcagaaattcttaggtttcaaggttgccttggatgatgagggggctgctgaaggc
tggctcttctgggatgatgggcaaagcattgatacctatgaaaaaggactctattacctg
gcgcacttttccgtcagccagaatatgatgcacagtcatataattttcaacaactacatc
agcaatacaaaccctttgagactgggctactttgaggtctggggagtgggcagtgactcc
atttccagtgtcagcatctctgcaagtggcgtggttataacacccaccttctcctacaac
tctacaacacaggtgttaaatattgatgtgaccagcagaaacatcagcctacataatttc
acttcattgatgtggagaagcacgccgaatttttag

DBGET integrated database retrieval system