KEGG   Bos taurus (cow): 100848905
Entry
100848905         CDS       T01008                                 

Gene name
SLX4IP
Definition
(RefSeq) protein SLX4IP
Organism
bta  Bos taurus (cow)
SSDB
Motif
Pfam: UPF0492
Other DBs
NCBI-GeneID: 100848905
NCBI-ProteinID: NP_001242902
UniProt: A0A3Q1MM08
LinkDB
Position
13
AA seq 271 aa
MASKKFAVKCGNFAVLVDLHVLPQGSSKDTSWFSEQKKEEVCLLLKETIDSRVKEYLQVR
KQHRPSDTEFTRSNPLSLKGYGFNITAYFLKRGIRLRCLRGSPRTELQVFPDRFVVCVSQ
LAFSRDLSASQSEDLQPGRALHRASGDRTGCVEQLLPPGAEPRRNVLREIVNRTETKSST
MSGSRSNRTSVGASSHSVAAEGAWRRRGLPASSSPPAMGQAEDDRKASETHQGLPALKLE
KGHQAWPGAAETSSQGAVADRASKQEPCLWL
NT seq 816 nt   +upstreamnt  +downstreamnt
atggcatcaaagaaatttgctgttaaatgtgggaactttgctgtcctggtggatcttcat
gtattgccgcaaggctcaagcaaagacactagctggttttctgaacagaagaaagaggaa
gtctgtttactgttaaaagaaaccattgattcaagagtgaaggagtacttacaagttcgt
aaacagcacaggccatcagatacagaattcacaagatccaatcccttgtccttaaaaggt
tacggctttaacatcacagcctacttcctaaaaagaggaatacgtctccgctgcctgagg
ggctcaccaaggacagaactgcaagtgtttcccgacaggtttgtggtctgtgtaagtcag
cttgcattcagtcgtgatctttcggcaagtcagagtgaagatttgcagccaggaagagct
ctccacagagcatcaggggatcgtactgggtgtgtggaacaactacttcctcccggggca
gagcccaggagaaacgttctgcgagaaattgtgaacagaactgagactaaaagcagcacc
atgagtggatctcggagcaacaggaccagtgtgggagcatccagtcactcggtggctgca
gagggagcatggaggaggcgggggctgccagcctcatccagccccccggccatgggacag
gcggaggatgacaggaaggcatctgagacccaccaggggcttcctgctctgaagctggag
aaaggtcatcaggcctggccaggagcagcagaaacctcatcccagggtgcggttgcagac
cgggcttctaagcaggagccttgtctgtggctgtga

DBGET integrated database retrieval system