KEGG   Bos taurus (cow): 104971426
Entry
104971426         CDS       T01008                                 

Gene name
AIM2
Definition
(RefSeq) LOW QUALITY PROTEIN: interferon-inducible protein AIM2
  KO
K12966  absent in melanoma 2
Organism
bta  Bos taurus (cow)
Pathway
bta04621  NOD-like receptor signaling pathway
bta04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104971426 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    104971426 (AIM2)
SSDB
Motif
Pfam: HIN
Other DBs
NCBI-GeneID: 104971426
NCBI-ProteinID: XP_024846140
LinkDB
Position
3
AA seq 223 aa
MAEVPLTNVFLRPKKGKQEMCHAAVSTESEFFFVKVFNNKLKDKFTPSKIIMISKYYWHS
CYLEVMLISLVCDTEFDQISVSKHIIRKDGDTSDYQKFGVGFIFSESRTEDHILCDLNDS
TGMIEVLMLGNEEKIQCKERNKLQLTFLELSKTGEKLYLKSRVHSFINGEGNGTPLQYNG
KSHTAKLKKLLVIALLVDSYIFDPLHKVSILTVYNLMNYDKWM
NT seq 672 nt   +upstreamnt  +downstreamnt
atggctgaagtgcctctgacaaatgtgttcttaaggcccaagaaagggaagcaggagatg
tgtcatgctgcagtgtctactgagagtgaattcttttttgtaaaagttttcaataacaaa
ctgaaggataaattcactccaagcaaaataattatgatatcaaaatattattggcacagt
tgttacctggaagtgatgctgatttccctggtgtgtgacactgaatttgaccagatcagt
gtctcaaagcatattatcagaaaagatggtgatacctcagattaccaaaagtttggtgtt
ggttttatcttttcagaaagcagaacagaagatcatatattatgtgacctaaatgacagc
acaggaatgatagaagtactgatgcttggaaatgaggagaaaatccagtgcaaggaacgg
aataaacttcaacttacattcttagagctatcaaagactggagaaaaactatacctgaaa
tctagagttcatagtttcattaacggagaaggcaatggcaccccactccagtacaatgga
aaatcccataccgccaagctaaagaaattattagtaattgctctacttgtagactcctac
atcttcgacccattgcacaaggtatcaatcctcacggtttacaacctaatgaactatgac
aaatggatgtag

DBGET integrated database retrieval system