KEGG   Bos taurus (cow): 107131750Help
Entry
107131750         CDS       T01008                                 

Definition
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
bta  Bos taurus (cow)
Pathway
bta05034  Alcoholism
bta05202  Transcriptional misregulation in cancer
bta05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    107131750
  Immune diseases
   05322 Systemic lupus erythematosus
    107131750
  Substance dependence
   05034 Alcoholism
    107131750
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    107131750
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107131750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 107131750
NCBI-ProteinID: XP_015315463
Ensembl: ENSBTAG00000031759
UniProt: P68432
LinkDB All DBs
Position
23
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtactaagcagacagcccgcaagtccaccggtggtaaagcaccgcgcaagcag
ctggctaccaaggcggcccgcaagagcgcgccagccaccggcggcgtgaagaagccgcac
cgctaccgccctggcacggtggccctgagagagatccgccgttaccagaagtccacggag
ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggcggtgatggcgctgcaggaggcgtgcgaggcctac
ctggtggggctcttcgaggacaccaacctttgtgccatccacgccaagcgcgtcaccatc
atgcccaaggacatccagcttgcccgccgcattcgcggggagagggcgtaa

DBGET integrated database retrieval system