KEGG   Bos taurus (cow): 280784
Entry
280784            CDS       T01008                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin precursor
  KO
K05437  erythropoietin
Organism
bta  Bos taurus (cow)
Pathway
bta04060  Cytokine-cytokine receptor interaction
bta04066  HIF-1 signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04630  JAK-STAT signaling pathway
bta04640  Hematopoietic cell lineage
bta05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    280784 (EPO)
   04066 HIF-1 signaling pathway
    280784 (EPO)
   04151 PI3K-Akt signaling pathway
    280784 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    280784 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    280784 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    280784 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bta04052]
    280784 (EPO)
Cytokines and growth factors [BR:bta04052]
 Cytokines
  CSF and other factors
   280784 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 280784
NCBI-ProteinID: NP_776334
BGD-bta: BT22257
Ensembl: ENSBTAG00000003430
VGNC: 28549
UniProt: P48617
LinkDB
Position
25
AA seq 192 aa
MGARDCTPLLMLSFLLFPLGFPVLGAPARLICDSRVLERYILEAREAENATMGCAEGCSF
NENITVPDTKVNFYAWKRMEVQQQALEVWQGLALLSEAILRGQALLANASQPCEALRLHV
DKAVSGLRSLTSLLRALGAQKEAISLPDATPSAAPLRAFTVDALSKLFRIYSNFLRGKLT
LYTGEACRRGDR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggcgcgcgactgtactccgctgctgatgctgtcctttctgctgtttcctttgggc
ttcccagtcctgggcgcccccgcacgcctcatctgtgacagccgagtcctggagaggtac
atcctggaggccagggaggccgaaaatgccacgatgggctgtgcagaaggctgcagcttc
aatgagaatatcactgtgccagacaccaaggttaacttctatgcctggaagaggatggag
gtccagcagcaggctctggaagtctggcagggcctggccctgctctcagaagctatcctg
cggggccaggccctattggccaacgcgtcccagccatgcgaggccctgcggctgcacgtg
gacaaagctgtcagcggcctccgcagtctcacctccctgcttcgggcgctgggagcccag
aaagaagccatctcccttccagatgcaaccccctccgcagccccactccgagcattcact
gttgatgctttgtccaagcttttccgaatctactccaatttcctgcggggaaagctgact
ctgtacacaggggaggcctgcaggagaggggacaggtga

DBGET integrated database retrieval system