KEGG   Bos taurus (cow): 280798Help
Entry
280798            CDS       T01008                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase precursor
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
bta  Bos taurus (cow)
Pathway
bta00052  Galactose metabolism
bta00500  Starch and sucrose metabolism
bta01100  Metabolic pathways
bta04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    280798 (GAA)
   00500 Starch and sucrose metabolism
    280798 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    280798 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    280798 (GAA)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     280798 (GAA)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   280798 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 280798
NCBI-ProteinID: NP_776338
BGD-bta: BT10606
Ensembl: ENSBTAG00000016021
VGNC: 29182
UniProt: Q9MYM4
LinkDB All DBs
Position
19
AA seq 937 aa AA seqDB search
MMRWPPCSRPLLGVCTLLSLALLGHILLHDLEVVPRELRGFSQDEIHQACQPGASSPECR
GSPRAAPTQCDLPPNSRFDCAPDKGITPQQCEARGCCYMPAEWPPDAQMGQPWCFFPPSY
PSYRLENLTTTETGYTATLTRAVPTFFPKDIMTLRLDMLMETESRLHFTIKDPANRRYEV
PLETPRVYSQAPFTLYSVEFSEEPFGVVVRRKLDGRVLLNTTVAPLFFADQFLQLSTSLP
SQHITGLAEHLGSLMLSTNWTKITLWNRDIAPEPNVNLYGSHPFYLVLEDGGLAHGVFLL
NSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHL
CRWGYSTSAITRQVVENMTRAYFPLDVQWNDLDYMDARRDFTFNKDHFGDFPAMVQELHQ
GGRRYIMIVDPAISSSGPAGTYRPYDEGLRRGVFITNETGQPLIGQVWPGLTAFPDFTNP
ETLDWWQDMVTEFHAQVPFDGMWIDMNEPSNFVRGSVDGCPDNSLENPPYLPGVVGGTLR
AATICASSHQFLSTHYDLHNLYGLTEALASHRALVKARGMRPFVISRSTFAGHGRYSGHW
TGDVWSNWEQLSYSVPEILLFNLLGVPLVGADICGFLGNTSEELCVRWTQLGAFYPFMRN
HNALNSQPQEPYRFSETAQQAMRKAFTLRYVLLPYLYTLFHRAHVRGETVARPLFLEFPE
DPSTWTVDRQLLWGEALLITPVLEAEKVEVTGYFPQGTWYDLQTVPMEAFGSLPPPAPLT
SVIHSKGQWVTLSAPLDTINVHLRAGHIIPMQGPALTTTESRKQHMALAVALTASGEAQG
ELFWDDGESLGVLDGGDYTQLIFLAKNNTFVNKLVHVSSEGASLQLRNVTVLGVATAPQQ
VLCNSVPVSNFTFSPDTETLAIPVSLTMGEQFVISWS
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggtggccaccatgctcccgccccctgctgggggtctgcaccctcctctccttg
gcgctcctggggcacatcctgcttcatgacttggaggtggtcccccgagaactacgaggc
ttctcccaagacgagattcaccaagcttgccagccaggagccagcagcccagaatgccgt
ggcagccccagggcagcacctacacagtgcgacctgccccccaacagccgctttgactgc
gccccagacaagggcatcaccccgcagcagtgtgaggcccgtggctgctgctacatgcct
gcagagtggcctccggatgcccagatggggcagccctggtgcttcttccctcccagctac
cccagttacaggctggagaacctgaccaccactgagacagggtacacagccaccctgacc
cgtgccgtcccgaccttcttccccaaggacatcatgaccttgaggctggacatgttgatg
gagaccgagagccgactccacttcacgatcaaagatcctgccaacagacgctatgaagtg
cccttggagaccccgcgtgtctatagccaggcgccgttcacactctacagcgtggagttc
tcggaggagccctttggggtggtcgtgcggcggaagctggacggacgggtgctgctgaac
accacggtggcccccctgttctttgcggaccagtttctgcagctgtccacctccctgcca
tcccagcacatcacaggccttgccgaacaccttgggtccctgatgctcagcaccaactgg
accaagatcaccctctggaaccgggacatcgcccctgagcccaacgtgaacctgtatgga
tctcaccctttctacctggtcctggaggatggcgggttggctcacggggtcttcctgctg
aacagcaatgccatggatgtggtcctgcagcccagcccagccctcagctggaggtcgaca
ggcgggatcctggacgtgtacatcttcctgggcccggagcccaagagcgtggtgcagcag
tacctggacgtcgtgggctacccgttcatgccgccgtattggggcctgggcttccacctg
tgccgctggggctactccacctctgccatcacccgccaggtcgtggagaatatgaccagg
gcctacttccccctggacgtccagtggaatgacctcgactacatggatgccagacgggac
ttcactttcaacaaggaccacttcggggacttcccggccatggtgcaggagctccaccag
ggcggtcggcggtacatcatgatcgtggatcctgccatcagcagctcaggccctgctggg
acctaccgaccctacgacgagggtctgaggcggggggtcttcatcaccaatgagactggg
cagccactgattgggcaggtgtggcccggactcaccgccttccccgacttcaccaacccc
gaaactcttgactggtggcaggacatggtgaccgagttccacgcccaagtgcccttcgat
ggcatgtggatcgatatgaacgagccatccaatttcgtgagaggctcagtggatggctgc
ccggacaacagcctggagaacccgccctacctgccaggggtggttggcgggaccctccgg
gcagccaccatctgtgcctccagccaccagttcctgtccacgcattatgacctgcacaac
ctgtatggcctgactgaagccttagcctcccacagggccctggtgaaggctcgagggatg
cgtcccttcgtgatctctcgctcaacctttgctggccacggccgatactccggccactgg
acaggggatgtgtggagcaactgggagcagctttcctactccgtgccagaaatcctgctt
ttcaatctgctgggggtgcccctggtaggggctgacatctgtggcttcctgggcaacacc
tcagaggagctgtgtgtgcgttggacccagctgggggccttctaccccttcatgcggaac
cacaatgccctgaacagccagccgcaggaaccgtacaggttcagcgagacggcgcagcaa
gccatgaggaaggccttcaccctgcgctacgtgctactgccctatctctacacactgttc
cacagggcccacgtcagaggcgagacagtggcccggcccctcttcctggagttccccgag
gaccccagcacctggactgtggaccgccagctcctgtggggggaggctctgctcatcacc
ccggtgctcgaggctgagaaggttgaagtcactggctacttcccccagggcacgtggtac
gacctgcagacggtaccaatggaggcctttggcagcctcccacctcctgcacccctcacg
tctgtcatccacagcaaggggcagtgggtgacgctgtccgccccgctggacaccatcaac
gtccacctccgggccgggcacatcatccctatgcagggccctgccctcacgaccacagag
tcccgcaagcagcacatggccctggctgtggccctgacagccagtggggaggcccaaggg
gagctgttctgggacgacggggagagcctgggagtgctggatggtggggactacacacag
ctcatctttctggccaagaacaacacctttgtaaacaagctggtgcacgtgagcagtgag
ggggccagcctgcagctgaggaatgtgaccgtcctgggggtggccacagccccccagcag
gtcctctgcaacagcgttcctgtctccaacttcaccttcagccctgacacagagactctg
gccatccctgtctcgctgaccatgggagagcagtttgtcatcagctggtcttaa

DBGET integrated database retrieval system