KEGG   Bos taurus (cow): 280817Help
Entry
280817            CDS       T01008                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00010  Glycolysis / Gluconeogenesis
bta00051  Fructose and mannose metabolism
bta00052  Galactose metabolism
bta00500  Starch and sucrose metabolism
bta00520  Amino sugar and nucleotide sugar metabolism
bta00524  Neomycin, kanamycin and gentamicin biosynthesis
bta01100  Metabolic pathways
bta01200  Carbon metabolism
bta04066  HIF-1 signaling pathway
bta04910  Insulin signaling pathway
bta04930  Type II diabetes mellitus
bta04973  Carbohydrate digestion and absorption
bta05230  Central carbon metabolism in cancer
Module
bta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bta_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    280817 (HK1)
   00051 Fructose and mannose metabolism
    280817 (HK1)
   00052 Galactose metabolism
    280817 (HK1)
   00500 Starch and sucrose metabolism
    280817 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    280817 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    280817 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    280817 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    280817 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    280817 (HK1)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    280817 (HK1)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    280817 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    280817 (HK1)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     280817 (HK1)
Membrane trafficking [BR:bta04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    280817 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD UvrD-helicase
Motif
Other DBs
NCBI-GeneID: 280817
NCBI-ProteinID: NP_001012686
Ensembl: ENSBTAG00000012380
VGNC: 29864
UniProt: Q5W5U3
LinkDB All DBs
Position
28
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLLDIMNRFKKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQNQAVHMESEVYDTPENIMH
GSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCRQSRIDEAILITWTKRFKASGV
EGTDVVKLLDKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCVNTEWGAFGDDGALEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCVAVQHVCTIVSFRSANLVAATLGAILSRLRDNKGTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDCDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFSLT
KEMLLEVKKRMRAEMELGLGKQTHDKAVVKMLPSFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRSVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPKMPLGF
TFSFPCKQTSLDAGILITWTKGFKATDCVGHDVATLLREAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVETLEGNQGQMCINMEWGAFGDNGCLDD
IRTIYDKLVDEFSLNSGKQRYEKMISGMYLGEIVRNILIDFAKRGFLFRGQISEPLKTRG
LFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRQEMSS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctagcttattacttcaccgaactgaaggatgaccaagtcaaa
aagattgacaagtatctctatgccatgcggctctctgatgaaactctgttagatatcatg
aatcgtttcaaaaaggagatgaagaatggcctctcccgggattttaatccgacagccaca
gtcaagatgttgccaacgtttgtaaggtctattcccgatggctcagaaaagggagatttc
atcgccctggatcttggcggatcttcctttcgaattctgcgggtgcaggtgaatcacgag
cagaaccaggctgttcatatggagtctgaggtttacgacaccccggagaacatcatgcat
ggcagtggaagccagctttttgatcacgtcgctgagtgcctgggagacttcatggagaaa
aaaaaaatcaaggacaagaaattacctgtgggattcacgttttctttcccttgtcggcaa
tccagaatagacgaggccatcctgatcacctggacaaagagatttaaagcgagcggcgtg
gagggaactgatgtggtgaagctgcttgacaaagccatcaaaaagcgtggggactatgat
gccaacattgtggctgtggtgaacgacacggtggggaccatgatgacctgtggctacgac
gaccagcagtgtgaagtcggcctcatcattggtaccggcaccaacgcgtgctacatggag
gagctgagacacatcgacctggtggagggcgacgaggggaggatgtgcgtcaacaccgag
tggggggcctttggggacgacggggccctggaggacatccgcaccgagttcgaccgggag
atagaccgggggtcgctcaaccccgggaagcagctgtttgagaagatggtcagtggcatg
tacctgggcgagctggtccgactgatcctggtcaagatggccaaggagggcctcttattt
gaagggcggatcaccccagagctgctcaccagagggaagtttaacaccagtgacgtgtcg
gccatcgaaaagaataaggaaggcctccacaatgccaaagaaatcctgacccgcctggga
gtggagccgtctgatgacgactgtgttgcggttcagcatgtgtgcaccatcgtctcattt
cgctctgccaacctggtggcggcgaccctgggtgccatcttgagccgccttcgagataac
aagggcacgcccaggctgcggaccacggttggtgtcgacgggtccctttacaagacgcac
ccacagtattctcggcgtttccacaagactctgcggcgcttggtacccgactgtgatgtg
cgtttcctcctctccgagagcggcagtggcaagggggccgccatggtgactgccgtggcc
taccgcctggctgagcagcaccggcagatagaggagaccctggcccacttcagcctcacc
aaggaaatgctgctggaggtgaaaaagcggatgcgggctgagatggaattggggctgggc
aagcagacgcatgacaaggctgtggtcaagatgttgccctccttcgtccggagcactcct
gatgggactgagaacggtgacttcttggccctggatcttggaggaacgaatttccgcgtc
ctgctggtgaaaatccgtagtgggaaaaagagatcggtggaaatgcacaataagatctac
gccattcccattgaaatcatgcagggcactggggaggagctgtttgaccacatcgtttcc
tgcatctctgacttcctggactacatgggcatcaagggccctaaaatgcctctgggcttc
acattttcgtttccctgcaagcagacgagcttagatgcgggtatcttaatcacctggacc
aaaggttttaaggcaaccgactgcgtggggcatgatgtagcaaccttactgagggaggcg
ataaaaaggagagaggaatttgacctggatgtggtggctgtggtcaacgacacggtgggc
accatgatgacctgtgcttatgaggagcccacctgcgaggttggactcatcgtagggact
ggcagcaatgcctgctacatggaggaaatgaaaaacgtcgagacgctagaaggaaaccag
ggacaaatgtgtatcaacatggagtggggtgcctttggggacaacgggtgtctggatgat
atcagaacaatctatgacaaactggtggatgagttttctctaaactctgggaagcaaagg
tatgagaagatgatcagcggtatgtacctgggtgagattgtccgcaacatcttgatcgac
ttcgccaagaggggcttcctcttccgggggcagatctctgagccgctgaagacccggggc
ctctttcagaccaagtatctctctcagatcgagagcgaccgattagcgctgctgcaggtc
cgggccatcctccagcagctgggcctgaacagcacgtgcgacgacagtatcctcgtgaag
accgtgtgtggggtggtgtccaagagggcggcgcagctgtgtggcgcaggcatggctgct
gtggtggataagatccgcgaaaacagggggctggaccgcctcaacgtgactgtgggcgtg
gacgggacgctctacaagcttcatccgcacttctccagaatcatgcaccaaaccgtgaag
gaactgtcaccaaagtgtaatgtgtccttcctcttatctgaagacggcagcggcaaggga
gccgccctcatcacagcggtgggcgttcggctccggcaagaaatgagcagctaa

DBGET integrated database retrieval system