KEGG   Bos taurus (cow): 280823
Entry
280823            CDS       T01008                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3 precursor
  KO
K04736  interleukin 3
Organism
bta  Bos taurus (cow)
Pathway
bta04060  Cytokine-cytokine receptor interaction
bta04151  PI3K-Akt signaling pathway
bta04210  Apoptosis
bta04630  JAK-STAT signaling pathway
bta04640  Hematopoietic cell lineage
bta04664  Fc epsilon RI signaling pathway
bta05200  Pathways in cancer
bta05202  Transcriptional misregulation in cancer
bta05221  Acute myeloid leukemia
bta05310  Asthma
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    280823 (IL3)
   04151 PI3K-Akt signaling pathway
    280823 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    280823 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    280823 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    280823 (IL3)
   04664 Fc epsilon RI signaling pathway
    280823 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    280823 (IL3)
   05202 Transcriptional misregulation in cancer
    280823 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    280823 (IL3)
  09163 Immune disease
   05310 Asthma
    280823 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bta04052]
    280823 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:bta00536]
    280823 (IL3)
Cytokines and growth factors [BR:bta04052]
 Cytokines
  Interleukins
   280823 (IL3)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate / Haparin
  Cytokines
   280823 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 280823
NCBI-ProteinID: NP_776345
BGD-bta: BT10593
Ensembl: ENSBTAG00000002140
UniProt: P49875
LinkDB
Position
7
AA seq 144 aa
MSSLSILHLLLLLLALHAPQAKGLPVVTSRTPYSMLMKEIMDDLKKITPSPEGSLNSDEK
NFLTKESLLQANLKVFMTFATDTFGSDSKIMKNLKEFQPVLPTATPTEDPIFIENKNLGD
FRMKLEEYLVIIRNYLKSKNIWFS
NT seq 435 nt   +upstreamnt  +downstreamnt
atgagcagtctctccatcttgcacctccttctgctcctgcttgcactccatgctcctcag
gcaaaggggttgcctgtcgtgacatcgaggactccatattctatgttgatgaaggaaatt
atggatgacctaaagaaaataactccgagtccagaaggctccttgaactcagatgagaag
aatttcctgacgaaagagagccttctgcaggcaaacctgaaagtattcatgacatttgcc
acagatacttttggaagcgattcaaaaatcatgaaaaatcttaaggaattccagccagtg
ctgcccacagccacacccacggaagatccaatttttattgagaacaagaacttgggcgat
ttccggatgaaattggaagaatatttggttatcattagaaactatctgaagtccaagaac
atatggttttcctaa

DBGET integrated database retrieval system