KEGG   Bos taurus (cow): 280824
Entry
280824            CDS       T01008                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 precursor
  KO
K05430  interleukin 4
Organism
bta  Bos taurus (cow)
Pathway
bta04060  Cytokine-cytokine receptor interaction
bta04151  PI3K-Akt signaling pathway
bta04630  JAK-STAT signaling pathway
bta04640  Hematopoietic cell lineage
bta04657  IL-17 signaling pathway
bta04658  Th1 and Th2 cell differentiation
bta04659  Th17 cell differentiation
bta04660  T cell receptor signaling pathway
bta04664  Fc epsilon RI signaling pathway
bta04672  Intestinal immune network for IgA production
bta05140  Leishmaniasis
bta05200  Pathways in cancer
bta05310  Asthma
bta05320  Autoimmune thyroid disease
bta05321  Inflammatory bowel disease
bta05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    280824 (IL4)
   04151 PI3K-Akt signaling pathway
    280824 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    280824 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    280824 (IL4)
   04660 T cell receptor signaling pathway
    280824 (IL4)
   04658 Th1 and Th2 cell differentiation
    280824 (IL4)
   04659 Th17 cell differentiation
    280824 (IL4)
   04657 IL-17 signaling pathway
    280824 (IL4)
   04664 Fc epsilon RI signaling pathway
    280824 (IL4)
   04672 Intestinal immune network for IgA production
    280824 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    280824 (IL4)
  09163 Immune disease
   05310 Asthma
    280824 (IL4)
   05320 Autoimmune thyroid disease
    280824 (IL4)
   05321 Inflammatory bowel disease
    280824 (IL4)
   05330 Allograft rejection
    280824 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    280824 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bta04052]
    280824 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:bta00536]
    280824 (IL4)
Cytokines and growth factors [BR:bta04052]
 Cytokines
  Interleukins
   280824 (IL4)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate / Haparin
  Cytokines
   280824 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 280824
NCBI-ProteinID: NP_776346
BGD-bta: BT10804
Ensembl: ENSBTAG00000015957
VGNC: 30161
UniProt: P30367
LinkDB
Position
7
AA seq 135 aa
MGLTYQLIPVLVCLLVCTSHFVHGHKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAP
KNTTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDL
LERLKTIMKEKYSKC
NT seq 408 nt   +upstreamnt  +downstreamnt
atgggtctcacctaccagctgatcccagtgctggtctgcttactggtatgtaccagtcac
ttcgtccatggacacaagtgtgatattaccttagcagagatcatcaaaacgctgaacatc
ctcacaacgagaaagaattcatgcatggagctgcctgtagcagacgtctttgctgcccca
aagaacacaactgagaaggaaaccttctgcagggttggaattgagcttaggcgtatctac
aggagccacacgtgcttgaacaaattcctgggcggacttgacaggaatctcaacagcttg
gcaagcaagacctgttctgtgaatgaagccaagacgagcacaagtacgctgaaagacctc
ttggaaaggctaaagacgattatgaaggagaaatactccaagtgttga

DBGET integrated database retrieval system