KEGG   Bos taurus (cow): 281160
Entry
281160            CDS       T01008                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04014  Ras signaling pathway
bta04015  Rap1 signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04390  Hippo signaling pathway
bta04810  Regulation of actin cytoskeleton
bta05200  Pathways in cancer
bta05218  Melanoma
bta05224  Breast cancer
bta05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    281160 (FGF1)
   04014 Ras signaling pathway
    281160 (FGF1)
   04015 Rap1 signaling pathway
    281160 (FGF1)
   04390 Hippo signaling pathway
    281160 (FGF1)
   04151 PI3K-Akt signaling pathway
    281160 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    281160 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    281160 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    281160 (FGF1)
   05218 Melanoma
    281160 (FGF1)
   05224 Breast cancer
    281160 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bta04052]
    281160 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:bta00536]
    281160 (FGF1)
Cytokines and growth factors [BR:bta04052]
 Growth factors
  Growth factors (RTK binding)
   281160 (FGF1)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   281160 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 281160
NCBI-ProteinID: NP_001300935
BGD-bta: BT11042
Ensembl: ENSBTAG00000005198
VGNC: 28970
UniProt: P03968
LinkDB
Structure
PDB: 
1AFC 1BAR

Position
7
AA seq 155 aa
MAEGETTTFTALTEKFNLPLGNYKKPKLLYCSNGGYFLRILPDGTVDGTKDRSDQHIQLQ
LCAESIGEVYIKSTETGQFLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
HWFVGLKKNGRSKLGPRTHFGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggagaaaccacgaccttcacggccctgactgagaagtttaacctgcctcta
ggcaattacaagaagcccaagctcctctactgcagcaacgggggctacttcctgagaatc
ctcccagatggcacagtggatgggacgaaggacaggagcgaccagcacattcagctgcag
ctctgtgcggaaagcataggggaggtgtatattaagagtacggagactggccagttcttg
gccatggacaccgacgggcttttgtacggctcacagacacccaatgaggaatgtttgttc
ctggaaaggttggaggaaaaccattacaacacctacatatccaagaagcatgcagagaag
cattggttcgttggtctcaagaagaacggaaggtctaaactcggtcctcggactcacttc
ggccagaaagccatcttgtttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system