KEGG   Bos taurus (cow): 281480Help
Entry
281480            CDS       T01008                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00020  Citrate cycle (TCA cycle)
bta00190  Oxidative phosphorylation
bta01100  Metabolic pathways
bta01200  Carbon metabolism
bta04714  Thermogenesis
bta04932  Non-alcoholic fatty liver disease (NAFLD)
bta05010  Alzheimer disease
bta05012  Parkinson disease
bta05016  Huntington disease
Module
bta_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bta_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bta_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    281480 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    281480 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    281480 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    281480 (SDHA)
   05012 Parkinson disease
    281480 (SDHA)
   05016 Huntington disease
    281480 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    281480 (SDHA)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     281480 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3 GIDA
Motif
Other DBs
NCBI-GeneID: 281480
NCBI-ProteinID: NP_776603
Ensembl: ENSBTAG00000046019
VGNC: 34388
UniProt: P31039
LinkDB All DBs
Position
20
AA seq 665 aa AA seqDB search
MSGVAAVSRLWRARRLALTCTKWSAAWQTGTRSFHFTVDGNKRSSAKVSDAISAQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMESGECRGVIALCI
EERVHPPHQGQEHCHRHRSYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGP
EKDHVYLQLHHLPPAQLAMRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLRHVNGQDQGVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGD
KVPSIKPNAGEESVMNLDKLRFANGSIRTSELRLNMQKSMQSHAAVFRVGSVLQEGCEKI
SSLYGDLRHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGGPRREDFKE
RVDEYDYSKPIQGQQKKPFEQHWRKHTLSYVDIKTGKVTLEYRPVIDRTLNETDCATVPP
AIGSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggttgccgctgtgtcgcgcttgtggcgcgcccggcgcctggcgctgacctgc
acgaagtggtcggcagcatggcagacaggaacccgcagttttcacttcaccgttgatggc
aataagaggtcgtccgctaaagtttcagatgcgatttctgcgcagtatccagttgtggac
catgagtttgatgccgtggtggttggtgccgggggggcaggcctgcgggccgcgttcggc
ctctctgaagcaggtttcaacacggcctgcgtcacgaagctcttccccaccagatcccac
actgtcgcggcccagggagggatcaatgccgccctggggaacatggaggaggacaactgg
cggtggcacttctacgacaccgtgaaaggctccgactggctgggggaccaggacgccatc
cattacatgaccgagcaggcccccgcctctgtggtggagctggagaattacggcatgccc
tttagcagaactgaagatggcaagatctaccagcgtgcctttggcggacagagcctcaag
ttcgggaagggtgggcaggcccatcgctgctgctgcgtggccgaccgcacgggccactcg
ctgctgcacacgttgtatggaaggtctctgcgctatgacaccagctactttgtggagtac
tttgctctggacctcctgatggagagcggggagtgccgcggtgtgatcgctctgtgcata
gaagaacgggtccatccaccgcatcagggccaggaacactgtcatcgccaccggagctac
gggcgcacctacttcagctgcacgtccgcccacaccagcaccggggacggcactgccatg
gtgaccagggctggcctgccctgccaggacctggagttcgtgcagttccaccccacaggc
atatatggcgctggctgtctcatcacagagggctgtcgtggagaggggggcatcctcatc
aacagccagggtgagaggttcatggagcgctacgcccccgtcgctaaggacctggcgtcc
agggatgtcgtgtcccggtccatgaccctggaaatccgcgagggaagaggctgtgggccc
gagaaggaccatgtgtacctgcagctgcaccacctgcccccagcacagctggctatgcgc
ctgcctggcatctcagagacggccatgatcttcgcgggcgtggacgtcaccaaggagccc
atccccgtgcttcccaccgtgcactacaacatgggtggcatccccaccaactacaagggg
caggttctgaggcacgtgaatggccaggaccagggtgtgcctggcctgtacgcatgcggg
gaggctgcctgcgcctcggtgcatggtgccaaccgtctgggtgcaaactcgctcctggac
ctggttgtcttcggccgggcgtgcgccctgagcatcgcagagtcctgcagacccggagat
aaagttccctcgattaaaccaaatgctggggaagaatctgtcatgaatcttgacaaattg
agatttgccaatggaagcataaggacatcggaactgcgactcaacatgcagaagtcgatg
cagagccatgccgcggtgttccgtgtggggagtgtgctgcaggaaggctgtgagaagatc
agcagcctctacggagacctgcggcatctgaagacgttcgacaggggaatggtctggaac
actgacctggtggagaccctggagctgcagaacctgatgctttgtgctctgcagaccatc
tacggagcggaggcccggaaggagtcgcgcggcggcccacgcagggaggacttcaaggag
agggttgacgagtacgattactccaagcccatccaggggcagcagaagaagccctttgag
cagcactggaggaagcacacgctctcctacgttgacatcaagactgggaaggtcaccctg
gagtacagacctgtaatcgacagaactttgaacgagactgactgcgccactgttccccca
gccatcggctcctactga

DBGET integrated database retrieval system