KEGG   Bos taurus (cow): 281496Help
Entry
281496            CDS       T01008                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial precursor
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bta  Bos taurus (cow)
Pathway
bta04068  FoxO signaling pathway
bta04146  Peroxisome
bta04211  Longevity regulating pathway
bta04213  Longevity regulating pathway - multiple species
bta05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    281496 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    281496 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    281496 (SOD2)
   04213 Longevity regulating pathway - multiple species
    281496 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    281496 (SOD2)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     281496 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 281496
NCBI-ProteinID: NP_963285
BGD-bta: BT29128
Ensembl: ENSBTAG00000006523
UniProt: P41976
LinkDB All DBs
Position
9
AA seq 222 aa AA seqDB search
MLSRAACSTSRRLVPALSVLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVAEEKYREALEKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPQGELLEA
IKRDFGSFAKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTARYTACSK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgcgagcggcgtgcagcacgagcaggagactggtgccggccctgagcgtgctg
ggctcccggcagaagcacagcctccccgacctgccgtacgactacggcgccctggagccg
cacatcaacgcgcagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac
aacctcaacgtcgccgaggagaagtaccgggaggcgctggagaagggtgatgttacagct
cagatagctctgcagcctgcgttgaagttcaacggtgggggccatatcaatcacagcatc
ttctggacaaatctgagccctaacggtggtggagaaccccaaggggaattgctggaagcc
atcaaacgtgactttggttcctttgccaaatttaaggaaaagttgactgctgtatctgtt
ggtgtccaaggctccggttggggttggctcggcttcaataaggagcagggacgcttacag
attgctgcttgttctaaccaggatcccctgcaaggaacaacaggtcttatccccctgctg
gggattgacgtgtgggagcatgcttattaccttcagtataaaaatgtcaggcccgattat
ctgaaggccatttggaatgtgatcaactgggagaatgtaactgcacgatacacggcttgc
agcaagtaa

DBGET integrated database retrieval system