KEGG   Bos taurus (cow): 281855
Entry
281855            CDS       T01008                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
bta  Bos taurus (cow)
Pathway
bta01523  Antifolate resistance
bta04010  MAPK signaling pathway
bta04014  Ras signaling pathway
bta04062  Chemokine signaling pathway
bta04064  NF-kappa B signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04210  Apoptosis
bta04380  Osteoclast differentiation
bta04620  Toll-like receptor signaling pathway
bta04621  NOD-like receptor signaling pathway
bta04622  RIG-I-like receptor signaling pathway
bta04623  Cytosolic DNA-sensing pathway
bta04625  C-type lectin receptor signaling pathway
bta04657  IL-17 signaling pathway
bta04658  Th1 and Th2 cell differentiation
bta04659  Th17 cell differentiation
bta04660  T cell receptor signaling pathway
bta04662  B cell receptor signaling pathway
bta04668  TNF signaling pathway
bta04920  Adipocytokine signaling pathway
bta05132  Salmonella infection
bta05135  Yersinia infection
bta05142  Chagas disease
bta05145  Toxoplasmosis
bta05160  Hepatitis C
bta05161  Hepatitis B
bta05162  Measles
bta05163  Human cytomegalovirus infection
bta05164  Influenza A
bta05165  Human papillomavirus infection
bta05166  Human T-cell leukemia virus 1 infection
bta05167  Kaposi sarcoma-associated herpesvirus infection
bta05168  Herpes simplex virus 1 infection
bta05169  Epstein-Barr virus infection
bta05170  Human immunodeficiency virus 1 infection
bta05200  Pathways in cancer
bta05203  Viral carcinogenesis
bta05212  Pancreatic cancer
bta05215  Prostate cancer
bta05220  Chronic myeloid leukemia
bta05221  Acute myeloid leukemia
bta05222  Small cell lung cancer
bta05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bta05340  Primary immunodeficiency
bta05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    281855 (IKBKG)
   04014 Ras signaling pathway
    281855 (IKBKG)
   04064 NF-kappa B signaling pathway
    281855 (IKBKG)
   04668 TNF signaling pathway
    281855 (IKBKG)
   04151 PI3K-Akt signaling pathway
    281855 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    281855 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    281855 (IKBKG)
   04621 NOD-like receptor signaling pathway
    281855 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    281855 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    281855 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    281855 (IKBKG)
   04660 T cell receptor signaling pathway
    281855 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    281855 (IKBKG)
   04659 Th17 cell differentiation
    281855 (IKBKG)
   04657 IL-17 signaling pathway
    281855 (IKBKG)
   04662 B cell receptor signaling pathway
    281855 (IKBKG)
   04062 Chemokine signaling pathway
    281855 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    281855 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    281855 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    281855 (IKBKG)
   05203 Viral carcinogenesis
    281855 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    281855 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    281855 (IKBKG)
   05221 Acute myeloid leukemia
    281855 (IKBKG)
   05220 Chronic myeloid leukemia
    281855 (IKBKG)
   05215 Prostate cancer
    281855 (IKBKG)
   05222 Small cell lung cancer
    281855 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    281855 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    281855 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    281855 (IKBKG)
   05135 Yersinia infection
    281855 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    281855 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    281855 (IKBKG)
   05162 Measles
    281855 (IKBKG)
   05164 Influenza A
    281855 (IKBKG)
   05161 Hepatitis B
    281855 (IKBKG)
   05160 Hepatitis C
    281855 (IKBKG)
   05168 Herpes simplex virus 1 infection
    281855 (IKBKG)
   05163 Human cytomegalovirus infection
    281855 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    281855 (IKBKG)
   05169 Epstein-Barr virus infection
    281855 (IKBKG)
   05165 Human papillomavirus infection
    281855 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    281855 (IKBKG)
   05142 Chagas disease
    281855 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    281855 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bta01001]
    281855 (IKBKG)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   281855 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 LLC1 zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 281855
NCBI-ProteinID: NP_776779
BGD-bta: BT11757
Ensembl: ENSBTAG00000006268
VGNC: 30102
UniProt: Q95KU9
LinkDB
Position
X
AA seq 419 aa
MSRPPWKSPLCEMVQPSGSPAGDQDMLGEESSLGKPAMLHVPSEQGTPETFQRCLEENQE
LRDAIRQSNQMLRERCEELQHFQGNQREEKAFLMQKFQEARDLVVRLSLEKRELRQQREQ
ALKEVERLKTCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALESRARVASEK
ARQLESEREALEQRHSVQVDQLVLQNESMEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHMKSSMVSSERNRGLQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKEFLQEQLEQLQREYSRLKTSCQESARIEDMRKRH
VEVSQPPLAPGPAHHSFHLNPSSQRRSPPDEPPKFCCPKCQYQAPDIDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggcccccctggaagagtccactgtgtgagatggtgcagccgagtggcagtccg
gcaggggaccaggacatgctgggtgaagagtcttctctggggaagccagccatgctccac
gtgccttcagagcagggcacccctgagaccttccagcgctgtctggaggagaatcaagag
ctccgagacgccatccgccagagcaaccagatgctgcgcgagcgctgtgaggagctgcag
catttccagggcaaccagagggaggagaaggccttcctcatgcagaagttccaggaggcc
cgggacttggtggtgaggctgagcctggagaagcgtgaactgcgccagcagagggagcag
gccctgaaggaggtggagcgcctgaagacgtgccagcagcagatggctgaggacaaggcc
tcagtgaaagcccaggtaacgtccttgctgggggagctgcaagagagccagagtcgcttg
gaggctgccactaaggagcgccaggctttggagagcagggcccgggtggccagcgaaaag
gcccggcagctggagagcgagcgggaggcactggaacagcggcacagcgtgcaggtggac
cagcttgttctgcagaacgaaagcatggaagctgccctgcgcatggaacggcaggccgcc
tcggaggagaagcggaagctggcccagctgcaggtggcctatcaccagctcttccaagag
tatgacaatcacatgaagagcagcatggtgagcagtgagcggaaccgaggactgcagctg
gaggatctcaagcagcagctccagcaggctgaggaggccctggtggccaaacaggaagtg
atcgacaagctgaaggaggaggcggaacagcacaagattgtgatggagactgtcccagtg
ctaaaagcccaggcggatatctacaaggcagacttccaggccgagaggcaggcccgggag
aagctggctgagaagaaggaattcctgcaagaacagctggagcagctgcagagggaatac
agcaggctcaagaccagctgtcaggagtcagccaggattgaagacatgaggaagcggcac
gttgaggtctcccagccccccttagcccctggcccagctcatcactcctttcacctgaac
ccgtccagccagaggagaagcccccctgacgagccgcccaagttctgctgccccaagtgt
cagtatcaggctcctgacatagacaccctgcagatacacgtcatggagtgcatcgagtag

DBGET integrated database retrieval system