KEGG   Bos taurus (cow): 281885
Entry
281885            CDS       T01008                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand precursor
  KO
K05461  KIT ligand
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04014  Ras signaling pathway
bta04015  Rap1 signaling pathway
bta04072  Phospholipase D signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04640  Hematopoietic cell lineage
bta04916  Melanogenesis
bta05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    281885 (KITLG)
   04014 Ras signaling pathway
    281885 (KITLG)
   04015 Rap1 signaling pathway
    281885 (KITLG)
   04072 Phospholipase D signaling pathway
    281885 (KITLG)
   04151 PI3K-Akt signaling pathway
    281885 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    281885 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    281885 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    281885 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bta04052]
    281885 (KITLG)
Cytokines and growth factors [BR:bta04052]
 Growth factors
  Growth factors (RTK binding)
   281885 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 281885
NCBI-ProteinID: NP_776800
BGD-bta: BT10206
Ensembl: ENSBTAG00000017549
VGNC: 30619
UniProt: Q28132
LinkDB
Position
5
AA seq 274 aa
MKKTQTWIITCIYLQLLLFNPLVHTQGICSNRVTDDVKDVTKLVANLPKDYMITLKYVPG
MDVLPSHCWISEMVEQLSVSLTDLLDKFSNISEGLSNYCIIDKLVKIVDDLVECMEEHSS
ENVKKSSKSPEPRQFTPEKFFGIFNKSIDAFKDLEIVASKMSECVISSTSSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKASNSIEDSSLQWAAVALPAFFSLVIGFAFGAFYWKK
KQPNLTRTVENRQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctcgtccacactcaagggatctgcagtaaccgtgtgactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttcccaaagactatatgataaccctcaaatatgtccccggg
atggacgttttgcctagtcattgttggataagcgagatggtggaacaactgtcagtcagc
ttgactgatcttctggacaagttttcgaatatttctgaaggcttgagtaattattgtatc
atagacaaacttgtgaaaatagttgatgaccttgtggagtgcatggaagaacactcatct
gagaatgtaaaaaaatcatctaagagcccagaacccaggcagtttactcctgagaaattt
tttggaatttttaataaatccatcgatgccttcaaggacttggagatagtggcttctaaa
atgagtgaatgtgtgatttcctcaacatcaagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggcctcaaattccattgaagattccagcctacaatgggcagccgtagca
ttgccagcattcttttctcttgtgatcgggtttgcttttggggccttttactggaagaag
aaacaaccaaatcttacaaggacagttgaaaacagacagattaatgaagaggataatgaa
ataagtatgttgcaagagaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system