KEGG   Bos taurus (cow): 282023Help
Entry
282023            CDS       T01008                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2 precursor
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00590  Arachidonic acid metabolism
bta01100  Metabolic pathways
bta04064  NF-kappa B signaling pathway
bta04370  VEGF signaling pathway
bta04625  C-type lectin receptor signaling pathway
bta04657  IL-17 signaling pathway
bta04668  TNF signaling pathway
bta04723  Retrograde endocannabinoid signaling
bta04726  Serotonergic synapse
bta04913  Ovarian steroidogenesis
bta04921  Oxytocin signaling pathway
bta04923  Regulation of lipolysis in adipocytes
bta05140  Leishmaniasis
bta05163  Human cytomegalovirus infection
bta05165  Human papillomavirus infection
bta05167  Kaposi sarcoma-associated herpesvirus infection
bta05200  Pathways in cancer
bta05204  Chemical carcinogenesis
bta05206  MicroRNAs in cancer
bta05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    282023 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    282023 (PTGS2)
   04064 NF-kappa B signaling pathway
    282023 (PTGS2)
   04668 TNF signaling pathway
    282023 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    282023 (PTGS2)
   04657 IL-17 signaling pathway
    282023 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    282023 (PTGS2)
   04913 Ovarian steroidogenesis
    282023 (PTGS2)
   04921 Oxytocin signaling pathway
    282023 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    282023 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    282023 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    282023 (PTGS2)
   05206 MicroRNAs in cancer
    282023 (PTGS2)
   05204 Chemical carcinogenesis
    282023 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    282023 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    282023 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    282023 (PTGS2)
   05165 Human papillomavirus infection
    282023 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    282023 (PTGS2)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     282023 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 282023
NCBI-ProteinID: NP_776870
BGD-bta: BT11819
Ensembl: ENSBTAG00000014127
VGNC: 33512
UniProt: O62698
LinkDB All DBs
Position
16
AA seq 604 aa AA seqDB search
MLARALLLCAAVALSGAANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPNTVHYILTHFKGVWNIVNKISFLRNMIMRYVLTSRSHLIESPPTYNVHY
SYKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGRKELPDSKEVVKKVLLRRKFIPDPQGT
NLMFAFFAQHFTHQFFKTDFERGPAFTKGKNHGVDLSHIYGESLERQHKLRLFKDGKMKY
QMINGEMYPPTVKDTQVEMIYPPHVPEHLKFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDVFQIDGQEYNYQQFIYNNSVLLEHGLTQFVESFTRQRAGRV
AGGRNLPVAVEKVSKASIDQSREMKYQSFNEYRKRFLVKPYESFEELTGEKEMAAELEAL
YGDIDAMEFYPALLVEKPRPDAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFKIINTASIQSLICSNVKGCPFTSFSVQDTHLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgggccctgctgctctgcgctgccgtggcgctcagcggtgcagcaaatcct
tgctgttcccatccatgtcagaatcgaggtgtatgtatgagtgtaggatttgaccagtat
aaatgtgactgtacccgaacaggattctacggtgaaaactgtaccacacccgaatttctg
acaagaataaaattactcctgaaacccactcccaacacagtgcactacatacttacccac
ttcaaaggagtctggaacattgtcaataagatctccttcctgcgaaatatgattatgaga
tatgtgttgacgtcgagatcacatttgattgagagtccaccaacttataatgtgcactac
agctataaaagctgggaagccttttctaacctgtcttattataccagagctcttcctcct
gtgcctgatgactgcccaacacccatgggtgtgaaagggaggaaagagcttcctgattca
aaagaagttgtgaaaaaagtacttctaagaagaaagttcattcctgatccccagggcaca
aatctgatgtttgcattctttgcccagcacttcacccatcaatttttcaagacagatttt
gaacgaggaccagctttcactaagggaaagaaccatggggtggacttaagtcacatttat
ggtgaatctttagagagacagcataagctgcgccttttcaaggatggaaaaatgaaatat
cagatgattaatggagagatgtatcctcccacagtcaaagatactcaggtcgaaatgatc
tacccgcctcatgttcctgaacacttgaagtttgctgtgggccaggaagtctttggtctg
gtgcctggtctgatgatgtatgccaccatttggctacgggaacacaacagagtgtgtgat
gtgcttaaacaagagcatccagaatggggcgatgagcagttgttccagacaagcaggcta
atcctgataggagaaactattaagattgtgattgaagactacgtacagcacttgagtggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacagttccagtaccag
aaccgtattgctgctgagtttaacacgctctaccactggcatccccttctgcctgacgtc
tttcagattgatggtcaggagtacaactatcagcagtttatctataacaactctgtctta
ctggaacatggtctcactcagtttgttgaatcattcaccaggcaaagggctggcagggtc
gctggcggtaggaatcttccagtcgcagtagagaaagtatcaaaggcttcaattgaccag
agcagagagatgaaataccagtcttttaatgagtatcgcaaacgttttctcgtgaagccc
tatgaatcatttgaggaacttacaggagagaaggaaatggctgcagagttagaagcgctc
tatggagacatagatgccatggagttttatcccgcccttctggtagagaagccccgtcca
gacgccatctttggggagaccatggtagaagctggagcaccattctccctgaaaggactt
atgggtaatcctatatgctctcccgagtactggaagcctagcactttcggtggagaagta
ggttttaaaatcatcaacactgcctcaattcagtctctcatctgcagtaacgtgaaaggc
tgtccctttacctcattcagtgttcaagatacgcacctcaccaaaacggtcaccattaat
gcaagctcttcccactctggactagatgatatcaaccccacagtcctactaaaggaacgt
tcaaccgaactgtag

DBGET integrated database retrieval system