KEGG   Bos taurus (cow): 282160
Entry
282160            CDS       T01008                                 

Gene name
CACNB3
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit beta-3
  KO
K04864  voltage-dependent calcium channel beta-3
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04260  Cardiac muscle contraction
bta04261  Adrenergic signaling in cardiomyocytes
bta04921  Oxytocin signaling pathway
bta05410  Hypertrophic cardiomyopathy
bta05412  Arrhythmogenic right ventricular cardiomyopathy
bta05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    282160 (CACNB3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    282160 (CACNB3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    282160 (CACNB3)
   04261 Adrenergic signaling in cardiomyocytes
    282160 (CACNB3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    282160 (CACNB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    282160 (CACNB3)
   05414 Dilated cardiomyopathy
    282160 (CACNB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    282160 (CACNB3)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   282160 (CACNB3)
SSDB
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N SH3_1
Other DBs
NCBI-GeneID: 282160
NCBI-ProteinID: NP_776934
BGD-bta: BT23227
Ensembl: ENSBTAG00000021808
VGNC: 26685
UniProt: Q9MZL3
LinkDB
Position
5
AA seq 484 aa
MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPV
AFAVRTNVSYCGVLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPS
PQRLESIRLKQEQKARRSGNPSSLSDIGSRRSPPPSLAKQKQKQAEHIPPYDVVPSMRPV
VLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIER
SSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVL
QRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAEYLEVYWRAT
HHPAPALGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQR
SSRHLEEDYADAYHDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHNERNWQRNRPWP
KDSY
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgtatgacgactcctacgtgcccgggtttgaggactcggaggcgggttcagccgactcc
tataccagccgcccatctctggactcagacgtctccctggaggaggaccgggagagtgcc
cggcgtgaagtggagagccaggctcagcagcagctggaaagggccaagcacaaacctgtg
gcgtttgctgtgaggaccaatgtcagctactgtggtgtactggatgaggagtgtccggtc
cagggctctggagtcaactttgaggccaaagactttctgcacattaaagagaaatacagc
aatgactggtggatcgggcggctagtgaaagagggcggagacatcgccttcatccccagc
ccccagcgcctcgagagcatccgactcaagcaggagcagaaggccaggagatctgggaac
ccatccagcctgagtgacattggcagccgacgctccccacctccatctctagccaagcag
aagcaaaagcaggcggaacatattcctccatatgacgtggtaccctccatgcggcctgtg
gtgctggtgggaccctctctgaaaggttatgaggtcacagacatgatgcagaaggcgctc
ttcgacttcctcaaacataggtttgatggcaggatctctatcacccgagtcaccgcagac
ctctcactggcaaagcgatccgtgctcaacaatcctggcaagaggaccatcatcgagcgc
tcctctgcccgctccagcattgctgaagtacagagtgagattgagcgcatattcgagctg
gccaaatccctgcagctagtagtgttggatgccgacaccatcaaccacccggcacagctg
gccaagacctcgctggcccccatcatcgtctttgtcaaagtgtcctcaccgaaggtactc
cagcgtctcatccgctcccgggggaagtcgcagatgaagcacctgaccgtacagatgatg
gcatacgataagctggttcagtgcccacccgagtcatttgatgtgattctggatgaaaac
cagctggaagatgcctgcgagcacctggctgagtacctggaggtttactggagggcgacc
caccacccagccccggcccttgggcttctgggccctcccagtgccatccccggacttcag
aaccagcagctgctaggggagcgtggcgaggagcactcgcccctggagcgggacagcctg
atgccctcagatgaggccagcgagagctcccgccaagcctggacgggatcttcacagcgc
agctcccgccacctggaggaggactatgcagatgcctatcacgacctgtaccagcctcac
cgccaacacacctcggggctgcctagtgcaaatgggcacgacccccaagaccgcctcctg
gcccaggactcggagcacaaccacaatgagcggaactggcaacgtaaccggccctggccc
aaggacagctactga

DBGET integrated database retrieval system