KEGG   Bos taurus (cow): 282410
Entry
282410            CDS       T01008                                 

Gene name
CACNA1B
Definition
(RefSeq) voltage-dependent N-type calcium channel subunit alpha-1B
  KO
K04849  voltage-dependent calcium channel N type alpha-1B
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04020  Calcium signaling pathway
bta04721  Synaptic vesicle cycle
bta04723  Retrograde endocannabinoid signaling
bta04725  Cholinergic synapse
bta04726  Serotonergic synapse
bta04727  GABAergic synapse
bta04728  Dopaminergic synapse
bta04930  Type II diabetes mellitus
bta05016  Huntington disease
bta05020  Prion disease
bta05022  Pathways of neurodegeneration - multiple diseases
bta05032  Morphine addiction
bta05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    282410 (CACNA1B)
   04020 Calcium signaling pathway
    282410 (CACNA1B)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    282410 (CACNA1B)
   04725 Cholinergic synapse
    282410 (CACNA1B)
   04728 Dopaminergic synapse
    282410 (CACNA1B)
   04726 Serotonergic synapse
    282410 (CACNA1B)
   04723 Retrograde endocannabinoid signaling
    282410 (CACNA1B)
   04721 Synaptic vesicle cycle
    282410 (CACNA1B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    282410 (CACNA1B)
   05020 Prion disease
    282410 (CACNA1B)
   05022 Pathways of neurodegeneration - multiple diseases
    282410 (CACNA1B)
  09165 Substance dependence
   05032 Morphine addiction
    282410 (CACNA1B)
   05033 Nicotine addiction
    282410 (CACNA1B)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    282410 (CACNA1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    282410 (CACNA1B)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   282410 (CACNA1B)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 282410
NCBI-ProteinID: NP_777057
Ensembl: ENSBTAG00000007882
VGNC: 26673
UniProt: Q9TTA4
LinkDB
Position
11
AA seq 2331 aa
MVRFGDELGGRYGGPGGGERARGGGAGVAGGPGPGGLQPGQRVLYKQSIAQRARTMALYN
PIPVKQNCFTVNRSLFVFSEDNVVRKYAKRITEWPPFEYMILATIIANCIVLALEQHLPD
GDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVLHKGSYLRNGWNVMDFVVVLTGILA
TAGTDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAILMFAII
GLEFYMGKFHKACFPNSTDADPVGDFPCGREAPARLCEGDTECREYWAGPNFGITNFDNI
LFAILTVFQCITMEGWTDILYNTNDAAGNTWNWLYFLPLIIIGSFFMLNLVLGVLSGEFA
KERERVENRRAFLKLRRQQQIERELNGYLEWIFKAEEVMLAEEDKNAEEKSPLDVLKRAA
TKKSRNDLIHAEEGEDRFADLCAVGSPFARASLKSGKTESSSYFRRKEKMFRFFIRRLVK
AQSFYWVVLCVVALNTLCVAMVHYQQPQRLTTALYFAEFVFLGLFLTEMSLKMYGLGPRS
YFRSSFNCFDFGVIVGSIFEVVWAAIKPGTSFGISVLRALRLLRIFKVTKYWSSLRNLVV
SLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFQDETPTTNFDTFPAAILTVFQIL
TGEDWNAVMYHGIESQGGVSKGMFSSVYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTK
DEEEMEEAANQKLALQKAKEVAEVSPMSAANISIAARQQNSAKARSVWEQRASQLRLQNL
RASCEALYSEMDPEERLRFATSRHLRPDMKTHLDRPLVVEPGRDGARGPAGGKARPEGGE
AGEGADPPRRHHRHRDRDRDKAAAPAGEPDRADAPKAEGGEPGAREERARPRRSRSKEAA
GPREARSERGRGLGPDGGRRHHRRGSPEEAAEREPRRHRAHRHAPEPSREGAPGSKGERR
ARHRGGSRAGPREAESGEEPSRRHRARHKAPPAHEEAEKEAEAEDRDKEPRNHQPRESHC
DLEASVVIGVGPVHALPSTCLEKVEEQPEDADNQRNVTRMGSQPSDLSTAVRIPVTLTGP
PGETTVVPSGNVDLESQAEGKKEVEADDVMRSGPRPIVPYSSMFCLSPTNLLRRFCHYIV
TMQYFEMVILVVIALSSIALAAEDPVQTDSPRNNVLKYMDYIFTGVFTFEMVIKMIDLGL
LLHPGAYFRDLWNILDFIVVSGALVAFAFSGSKGKDISTIKSLRVLRVLRPLKTIKRLPK
LKAVFDCVVNSLKNVLNILIVYMLFMFIFAVIAVQLFKGKFFYCTDESKELERDCRGQYL
DYEKEEVEAQPRQWKKYDFHYDNVLWALLTLFTVSTGEGWPMVLKHSVDATYEEQGPSPG
FRMELSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKVMSECSLEKNERACIDFAISAK
PLTRYMPQNKQSFQYKTWTFVVSPPFEYFIMAMIALNTVVLMMKFYDAPYEYELMLKCLN
IVFTSMFSMECVLKVIAFGVLNYFRDAWNVFDFVTVLGSITDILVTEIANNFINLSFLRL
FRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIALDDD
TSINRHNNFRTFLQALMLLFRSATGEAWHEIMLSCLSSRACDELANATECGSDFAYFYFV
SFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFIRVWAEYDPAACGRISYNDM
FEMLKHMSPPLGLGKKCPARVAYKRLVRMNMPISNDDMTVHFTSTLMALIRTALEIKLAP
AGTKQHQCDAELRKEISSVWANLPQKTLDLLVPPHKPDEMTVGKVYAALMIFDFYKQNKT
TRDQIHQAPGGLAQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSASLSNGGAVQTQ
EGGIKESVSWGTQRTQEVPCEVRTPLERGHSTEIPVQTGKPAVDVQMQSMVLRGPDGEPQ
PGLESQGRAASMPRLAAETQPPPDASPMKRSISTLAPQRPHVAHLCTAALDRAPASQAAP
PHHHRCHRRRDRKQKSLEKGPGLSADTDGAPYSTAGPGPPPPPGDGAAGCRRERRQERGR
SQERRQPSSSSSEKQRFYSCDRFGGREPPQPKPSLSSHPTSPTAGQEPGPPRQGSGSVNG
SPLLSTSGASTPGRGGRRQLPQTPLTPRPSITYKTANSSPVHFAGAQTSLPAFSPGRLSR
GLSEHNALLQRDPLSQPLAPSSRIGSDPYLGQRLDSEAAARTQLEDTLTFEEAVATNSGR
SSRTSYVSSLTSQSHPLRRVPNGYHCTLGLSSGGGGRGRHSYHHPDQDHWC
NT seq 6996 nt   +upstreamnt  +downstreamnt
atggtccgcttcggggacgagctgggcggccgctatgggggccccggcggtggggagcgg
gcgcggggcggcggggccggcgttgcgggcggcccgggccccggggggctgcagccgggc
cagcgggtcctctacaagcagtcgatcgcgcagcgcgcgcggaccatggcgctgtacaac
cccatcccggtcaagcagaactgcttcaccgtcaaccgctcgctcttcgtcttcagcgag
gacaacgtcgtccgcaaatacgccaagcgcatcaccgagtggcctccgtttgagtacatg
attctggccaccatcatcgccaactgtatcgtgctggctctggagcagcacctcccagac
ggagacaagacgcccatgtctgagcggctggacgacacggagccctacttcatcggcatc
ttctgcttcgaggctgggatcaagatcatcgcgctgggctttgtcttgcacaagggctcc
tacctgcggaatggctggaacgtcatggacttcgtggtggtcctcacggggatcctcgcc
acagctggcactgactttgatctgcgaacactgcgggctgtgcgtgtactgaggcccctg
aagctggtgtctgggattccaagtttgcaggtggtgctcaagtccatcatgaaggccatg
gtcccgctcctgcagattgggctgcttctctttttcgccatcctcatgttcgccatcatt
ggcctcgagttctacatgggcaaattccacaaggcttgtttccccaacagcacagacgca
gatccggtgggtgacttcccgtgcggcagggaggccccggcgcggctgtgcgagggcgac
actgagtgccgggagtactgggcgggccccaacttcggcatcaccaacttcgacaacatc
ctgttcgccatcctgacggtgttccagtgcatcaccatggagggctggaccgacatcctc
tacaacaccaacgacgcggctggcaacacctggaactggctctacttcctgcccctgatt
atcatcggctcgttcttcatgctcaacctggtgctgggcgtgctctcaggagagtttgcc
aaggagcgtgagcgggtggagaaccgccgggcctttctgaagctccgccggcagcagcag
atcgagcgggagctcaatgggtacctggagtggatcttcaaggccgaggaggtcatgctg
gccgaggaggacaagaacgcagaggagaagtcccctctggatgtgttgaagagagcagcc
accaagaagagccgaaacgacctgatccacgcggaggagggagaggaccgctttgcagac
ctctgtgctgtggggtcccccttcgcccgagccagcctcaagagtgggaagacggagagc
tcgtcatacttccgcaggaaggagaagatgttccggttcttcatccggcgcctggtgaag
gcgcagagcttctactgggtggtgctgtgtgtggtggccctgaacacgctgtgcgtggcc
atggtgcactaccagcagccccagcggctcaccacggcgctgtactttgcagagtttgtt
ttcctgggtctcttcctcacagagatgtccctgaagatgtatggcctggggcccaggagc
tacttccggtcctccttcaactgcttcgatttcggggtcattgtggggagcattttcgaa
gtggtctgggcggccatcaagccaggaacctccttcggcatcagtgtgctgcgggcgctg
cggctgctgagaatcttcaaagtcaccaagtactggagctccctgcggaacctggtggtg
tccctgctcaactccatgaagtccatcatcagcctgctcttcctgctcttcctcttcatc
gtggtcttcgctctgctgggcatgcagctcttcgggggacagttcaacttccaggatgag
actccgacaaccaactttgacaccttccctgccgccatcctcactgtcttccagatcctg
accggggaggactggaatgcggtgatgtaccatgggatcgaatcacaaggtggagtcagc
aagggcatgttctcgtctgtgtacttcattgtcctgacgctgtttgggaactacaccctg
ctgaacgtcttcctggccatcgctgtggacaacctcgccaatgctcaggagctgaccaag
gacgaagaggagatggaagaagcagccaatcagaagcttgctctgcaaaaggccaaagaa
gtggctgaagtcagccccatgtctgccgcgaacatctccattgctgccaggcagcagaac
tcggccaaggcgcgctcggtgtgggagcagcgggccagccagctgcggctgcagaacctg
cgggccagctgtgaagcgctgtatagcgagatggaccccgaggagcgcctgcgcttcgcc
acttcccgccacctgcggcccgacatgaagacgcacctggaccggccgcttgtggtggag
ccaggccgggatggcgcgcgggggcctgcggggggcaaggcccggcccgagggcggagag
gccggcgagggtgccgacccgccgcgcaggcaccaccggcaccgcgacagggacagggac
aaggccgcagccccggcgggggagccagacagggcggacgccccgaaggcggagggcggg
gagccgggggcccgggaggagcgggcgcgaccgcgccgcagccgcagcaaggaggccgca
ggcccccgcgaggccaggagcgagcgaggccgcgggctgggcccggacggcggccggcgc
caccaccggcgcggctccccggaggaggccgcggagcgcgagccccggcgccaccgcgcg
caccggcacgcgccggagccgagcagggagggcgcgcccgggagcaagggcgagcggcga
gcgcggcaccgcggcggctcccgggccgggccccgggaggccgagagcggcgaggagccc
tcccggcggcaccgagcgcgacacaaggcgccgcccgcacacgaggaggcggagaaggag
gccgaggcggaggacagggacaaggagccccgaaaccaccagcccagggagtcgcactgt
gacctggaggccagtgtggtcattggtgtgggccctgtgcatgccctgcccagcacttgt
ctagagaaggtggaagagcagccagaggatgcagacaatcagcggaatgtgactcgcatg
ggcagtcagccctcagatctgagcaccgctgtgcgtatcccagtgacgctgaccgggcct
cccggggagaccacggttgttcccagtggtaacgtggacctggaaagccaagcagaagga
aagaaggaggtggaagctgatgacgtgatgaggagtggcccccgacccattgtcccgtac
agctccatgttctgcttgagccccaccaacctgctccgccgcttctgccactacattgtg
accatgcagtacttcgagatggtcattctcgtggtcattgccctgagtagcattgccctg
gctgcggaggatcctgtgcagacagactcgcccaggaacaacgtgctgaagtacatggac
tacatcttcacaggtgtcttcacctttgagatggtgataaagatgatcgatttgggactg
ctgctgcaccccggtgcctacttccgggatctgtggaacattctggacttcattgtggtc
agtggggccctggtggcgtttgccttctcaggctccaaagggaaagacatcagcaccatc
aagtccctgagggtcctgcgtgtgctgaggccactcaagaccatcaagcggctgcccaag
ctcaaagctgtgtttgactgtgtggtgaactccctgaagaacgtcctcaacatcctgatc
gtctacatgctcttcatgttcatatttgctgtcatcgcggtacagctcttcaaggggaag
tttttctactgcaccgacgagtccaaggagctggagcgggactgcaggggccagtatttg
gactacgagaaggaggaggtggaagctcagccgcggcagtggaagaaatacgacttccac
tatgacaacgtgctgtgggccctgctaacgctgttcactgtgtccacgggcgaagggtgg
cccatggtgctgaaacactcggtggatgccacctacgaggagcagggccccagccccggg
ttccgcatggagctgtccatcttctatgtggtctacttcgtggtcttccccttcttcttt
gtgaacatctttgtggccttgatcatcatcaccttccaggagcagggggacaaagtcatg
tctgagtgcagcttggagaagaacgagagggcttgtatcgacttcgccattagcgccaaa
cccctgacgcggtacatgccccagaacaagcagtcgttccagtacaagacgtggacgttc
gtggtctcaccaccctttgagtatttcatcatggccatgatagccctcaacacagtggtg
ctgatgatgaagttctacgatgcgccctacgagtacgaactgatgttgaagtgtctgaac
atcgtgttcacgtccatgttctccatggagtgtgtgctcaaggtcatcgcctttggagtg
ctgaactatttcagagacgcctggaatgtctttgactttgtcactgtgttgggaagtatt
actgatattttagtaacagagattgcgaacaacttcatcaacctcagcttcctccgcctc
ttccgtgctgcccgactcatcaagctgctccgccaaggctacaccatccgcattctgctc
tggaccttcgtccagtccttcaaggccctgccctatgtgtgcctgctcatcgccatgctg
ttcttcatctacgccatcatcggcatgcaggtgtttggaaacattgctctggatgacgac
accagcatcaaccgtcacaataactttcggacatttcttcaggccttgatgctgctcttc
aggagtgccaccggggaggcctggcatgagatcatgctgtcctgcctcagcagtcgggcc
tgtgatgagctcgccaatgccacggagtgtgggagtgacttcgcctacttctactttgtc
tccttcatcttcctttgctcctttctgatgttgaacctctttgtggctgtgatcatggac
aattttgagtaccttacgcgggactcttccatcctagggcctcaccacctggacgaattc
atccgggtctgggccgagtacgacccggctgcgtgtgggcgcatcagttacaatgacatg
tttgagatgctgaaacacatgtccccgcccctggggctggggaagaaatgccctgctcgt
gttgcgtacaagcgcctggttcgtatgaacatgcccatctccaatgacgacatgaccgtc
cacttcacatccacgctgatggccctcatccggactgcattggagatcaagctggctcca
gctggcacgaagcagcatcagtgtgacgcagagctgaggaaggagatctcctccgtgtgg
gccaatctgccccagaagaccctggacttactggtgccaccccataaacccgacgagatg
acggtggggaaggtgtacgcagctctgatgatattcgacttctacaaacagaacaaaacc
accagagaccagattcaccaagctcctggaggcctggcccagatgggccccgtgtccctg
ttccaccccctgaaggccacgctggagcagactcagccggctgtgctccgaggagcccgc
gttttccttcggcagaagagctcggcctccctcagcaacggtggggcagtacaaacccaa
gagggcggcatcaaggagtctgtctcctggggcactcagaggacccaggaggtcccctgc
gaggtgaggacacccctggagcgtggccactccacagagatcccggtgcagacaggaaaa
ccggctgtggacgtccagatgcagagcatggtcctgagaggccctgacggggagccccaa
cctgggctggagagccagggccgagcagcttccatgccccgcctggcagcagagactcag
ccacccccagatgccagccccatgaagcgctccatctccacactggcaccccagaggccc
cacgtggctcatctgtgcaccgcggccctggaccgcgctccagccagccaggccgccccc
ccccaccaccaccgctgccatcgccgcagggaccggaagcagaagtccctggagaagggg
cccggcctgtctgcagacacagatggcgcgccctacagcaccgcggggccgggccccccg
ccgcccccaggggatggggcagcaggctgccggcgggagcgcaggcaggagcggggccgg
tcccaggagcggaggcagccctcctcctcttcctctgagaagcagcgcttctactcctgt
gaccgctttgggggccgtgagcccccgcagcccaagccctctctcagcagccatcccacg
tcgcccacggccgggcaggagccaggacccccgagacagggtagcggctccgtgaacggg
agccccctgctgtcgacatctggtgctagcacccctggccgcggcgggcggaggcagctc
ccccagaccccgctgaccccccgtcccagcatcacctataagacggccaactcctcacct
gtccactttgccggggctcagaccagcctccctgccttttcccccggccggcttagccgt
ggcctttcggaacacaacgccctgctccagagagaccccctcagccagccgctggccccc
agctctcggattggctccgacccttacctggggcagcgtctggacagtgaggctgcggcc
cgcacccagcttgaggacacgctcaccttcgaggaggccgtggccaccaactcgggccgc
tcctcccggacttcctacgtgtcctccctgacctcgcagtcccaccccctccgccgggtg
cccaacggctaccactgcactctggggctcagctcgggcgggggcggccgggggcggcac
agctaccaccaccctgaccaagaccactggtgctag

DBGET integrated database retrieval system