KEGG   Bos taurus (cow): 282411
Entry
282411            CDS       T01008                                 

Gene name
CACNA1G
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1G
  KO
K04854  voltage-dependent calcium channel T type alpha-1G
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04020  Calcium signaling pathway
bta04713  Circadian entrainment
bta04925  Aldosterone synthesis and secretion
bta04927  Cortisol synthesis and secretion
bta04929  GnRH secretion
bta04930  Type II diabetes mellitus
bta04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    282411 (CACNA1G)
   04020 Calcium signaling pathway
    282411 (CACNA1G)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    282411 (CACNA1G)
   04925 Aldosterone synthesis and secretion
    282411 (CACNA1G)
   04927 Cortisol synthesis and secretion
    282411 (CACNA1G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    282411 (CACNA1G)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    282411 (CACNA1G)
   04934 Cushing syndrome
    282411 (CACNA1G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    282411 (CACNA1G)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   282411 (CACNA1G)
SSDB
Motif
Pfam: Ion_trans PKD_channel SieB
Other DBs
NCBI-GeneID: 282411
NCBI-ProteinID: NP_001180069
BGD-bta: BT11773
Ensembl: ENSBTAG00000009835
VGNC: 26677
LinkDB
Position
19
AA seq 2380 aa
MDEEEDGAGAEESGQPRSFMRLNDLSGARDRPGPGSAEKDPGSADSEAEGLPYPALAPVV
FFYLSQDSRPRSWCLRTVCNPWFERISMLVILLNCVTLGMFRPCEDIACDSQRCRILQAF
DDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVR
TVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNR
CFLPENFSLPLSVDLERYYQTENEDENPFICSQPRENGMRSCRSVPTLRGDGGGGPPCGL
DYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEGWVDIM
YFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNA
STLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAAGVRVGLLSSPAPRGGQEPQPSG
GCPRPHRRPSVHHLVHHHHHHHYHLGNGTLRAPRPSPQIQDRDASGSRRLVLPPPSTPAL
SRGPPGGAEAVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVDSGKVYPTVHTSPPPEML
KEKALMEVAPASGPTTLTSLNIPPRPYSSMHKLLETQSTGACQSSCKISSPCLRAASGAC
GPDSCPYCARTGAGEVGLTGHEMPDSDSEAVYEFTQDAQHGDLRDPHSRRRRSLGLDVEP
NSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNALEISNIVF
TSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLMRVL
KLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTLPD
RKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLLVAI
LVEGFQTEEISKREDASGQLSCIQLPVDSQGGDATKSESEPDFFSPSLDGDGDRKKRLAL
VSLGEHPELRRSLLPPLIIHTAATPMSLPKSSSSGLAEVLGPPSRRTSSSGSAEPGAPHE
MKSPPSVRSSPHSPWSAASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGRESQDE
EESSEEERTSPAGSDRHHRGSLEREAKSSFDLPDTLQVPGLYRTASGRSSASEHQDCNGN
SAVGRLSQAVRPDDPPLDGDDGDDEGNLSKAERLRAWIRTRLPVCCLERDSWSAYIFPPQ
SRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNYIFTAVFL
AEMTVKVVALGWCFGEQAYLRSSWNVLDGLLVLISIIDILVSMVSDSGTKILGMLRVLRL
LRTLRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFVCQ
GEDTRNITNKSDCAEASYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVD
QQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRLRR
LEKKRRNLMLDDVIASGSSASAAPEAQCKPYYSDYSRFRLLVHHLCTSHYLDLFITGVIG
LNVVTMAMEHYQQPQILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDLAI
VLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQALPQ
VGNLGLLFMLLFFIFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFRVSTGD
NWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKEAK
EEAELEAELELEMKTLSPQAPSPLGSPFLWPGVEGPDSPGSPKPGAPHATPHTGAASRFS
LEHPMDRQLFDTISLLIQGSLDGELKLMDELAGPGGQPSAFPPACSPGGSDPQIPLAEME
ALSLTSEIVSELSCSLALTDDCLPDDTHTLLLSALASNMESHPEEVPVMLGPDLLTVRKS
GVSRTHSLPNDSYMCRDGSTAEGSLGHRGWGLPRAQSGSILSVHSQPADTSYIPQLPKDA
PHLLQPHGAPTWGTIPKLPPPGRSPLAQRPLRRQAAIRTDSLDIQGLGSREDLLSEVSGP
SPPLARASSFWGHSSTQAQQHSRSQSKILKHMPPSAPCPGPELKWAKGPPETRSSLELDT
ELSWISGDLLPTDSQEEAPSARDLKKCYSVEAQSCPRRPASWLDEQRRHSIAVSCLDSGS
QPALGPDPSSLGGQPLGGAGSRPKKKLSPPSISIDPPESQSQGPRPPPSPGVCLRRRAPS
SDSKDPLASGPPDSMAASPSPKKDVLSLSGLSSDPADLDP
NT seq 7143 nt   +upstreamnt  +downstreamnt
atggacgaggaggaggatggagcgggcgccgaggagtcaggacagccccggagcttcatg
cggctcaacgacctgtcgggggccagggaccggccggggccggggtcggcggaaaaggac
cccggcagcgcggactccgaggcggaggggctgccataccctgcactggccccggtggtt
ttcttctacttgagccaggacagccgcccgcggagctggtgtctccgcacggtctgtaac
ccctggtttgagcgcatcagtatgttggtcatccttctcaactgtgtgaccctgggcatg
ttccggccatgtgaagacatcgcctgtgactcccagcgctgccggattctgcaggccttt
gatgacttcatctttgccttcttcgctgtggagatggtggtgaagatggtggccttgggc
atctttggaaaaaaatgttacctgggagacacttggaaccggcttgactttttcatcgtc
attgcagggatgctggagtattcgctggacctgcagaatgtcagcttctcagctgtcagg
acagtccgtgtgcttcgacccctcagggccattaaccgggtgcccagcatgcgcatcctc
gtcacgctgctgctggacacgctgcccatgctgggcaacgtcctgctgctctgcttcttc
gtcttcttcatcttcggcatcgttggtgtccagctgtgggcaggactgcttcgtaaccga
tgcttcctgcctgagaatttcagcctccccctgagcgtggacttggagcgctactaccag
actgagaacgaggatgagaacccattcatctgctcccagcctcgtgaaaacggcatgcgc
tcctgcaggagtgtgcccacgctgcgcggggacgggggtggcggcccaccctgcggcctg
gactacgaggcctacaacagctccagcaacaccacctgtgtgaactggaaccagtactac
accaactgctccgcgggggagcacaaccccttcaagggtgccatcaacttcgacaacatt
ggctatgcctggatcgccatcttccaggtcatcacgctggagggctgggtcgacatcatg
tactttgtgatggatgctcactccttctacaacttcatctacttcatccttctcatcatt
gtgggctctttctttatgatcaacctgtgcctggtggtgattgccacgcagttctcagag
accaagcagcgggagagccagctgatgcgggagcagcgcgtgagattcctttccaacgcc
agcaccctggccagcttctccgagcccggcagctgctatgaggagctgctcaagtacctc
gtgtatatcctccggaaagcagcccgaaggctggcccaggtctcccgggcggcgggcgtg
cgggttggcctgctgagcagcccagcgccccgtgggggccaggagccccagcccagtggc
ggctgccctcgcccccaccgccgtccatccgtccaccatctggtgcaccaccaccaccac
caccactaccacttgggcaatgggactctgcgggcccctcggcccagcccgcagatccag
gacagagatgccagtgggtcccgccggctcgtgctgccaccaccctcaactcctgccctt
tccaggggccctccagggggtgcagaggctgtgcacagcttctaccatgctgattgccac
ttggagccagtccgctgccaggcaccccctcccaggtcgccatcggaggcatcgggcagg
accgtggacagtgggaaggtgtaccccaccgtgcacaccagccctccacctgagatgctc
aaagagaaggcactaatggaggtggcgcccgcctctggacccaccaccctcaccagcctc
aacatcccacccaggccctacagctctatgcacaagctgctggagacccagagcacaggc
gcctgccaaagctcttgcaagatctccagcccttgcttgagggcagccagcggagcctgt
ggcccagacagctgtccctactgtgcccggactggggcaggggaggtggggctcactggc
cacgagatgcctgactcagacagtgaggcggtttatgagttcacacaagatgctcagcat
ggcgacctccgggatccccacagtcggcgtcgacggagcctggggctggatgtggagccc
aactctgtgctggccttctggaggctgatctgtgacaccttccggaagattgtggacagc
aagtactttggtcggggaatcatgattgctattctggtcaacacgctcagcatgggcatc
gaataccacgagcagcctgaggagctcaccaatgccctggaaatcagcaacatcgtcttc
accagcctctttgccctggagatgctgctgaagctgctagtatatggtccctttggctac
attaagaacccctacaacatctttgatggcgtcattgttgtcatcagcgtgtgggagatc
gtgggccagcaggggggcggcctgtcggtgctgcggaccttccgcctgatgcgggtgctg
aagctggtgcgcttcttgccggcgctgcagcggcagctcgtggtgctcatgaagaccatg
gacaacgtggccaccttctgcatgctgctcatgctcttcatcttcatcttcagcatcctg
ggtatgcatctcttcggctgcaaatttgcatctgagcgggatggggacacgttgccggac
cggaagaattttgactccctgctctgggccatcgtcactgtctttcagatcctgactcag
gaggactggaacaaggtgctctacaacggaatggcctccacgtcatcctgggctgccctt
tacttcatcgccctcatgaccttcggcaactatgtgctcttcaacctgctcgttgccatt
ctggtggagggcttccaaacggaggaaatcagcaaacgggaagatgcgagtggacagtta
agctgtattcagctgcctgtcgactcccaggggggagatgccaccaagtcagagtcggaa
cctgatttcttctcgcccagcctggatggtgatggggacaggaagaagcgcttggccttg
gtgtctctgggagagcacccggagctgcggaggagcttgttaccaccgctcatcatccac
acggctgccactcccatgtcattgcccaaaagctccagcagcggcctggccgaggttctg
ggccccccctcccgccgcaccagcagcagtgggtcggctgagccaggagcacctcacgag
atgaagtcaccgccaagtgtccgcagttccccccacagcccctggagtgcagcaagcagc
tggacgagcaggcgctccagcaggaacagcctgggccgtgcccccagcctgaagcgaagg
agcccaagtggggagcggaggtccttgttgtcgggtgagggccgggagagccaggatgag
gaggagagctcggaagaggagcgcactagcccagcgggcagtgaccgccaccacaggggc
tccctggagagggaagctaagagctcctttgacctaccggacacactgcaggttcccggg
ctgtaccgcacagccagcggccgcagctcagcctctgagcaccaggactgcaacggcaat
tcggccgtgggacgcctgagtcaggctgtgcggcccgatgaccccccgttggatggagac
gatggtgatgacgagggcaacttgagcaaagcagaacggctgagggcgtggatccgaacc
cggctccctgtctgctgcctggagcgagactcttggtctgcctacatcttccctcctcag
tcaaggttccgcctcctgtgtcaccgaatcatcacccacaagatgtttgaccacgtggtc
ctcgtcatcatcttcctgaactgtatcaccatcgccatggagcgccccaagatcgacccc
cacagcgctgaacgaattttcctgaccctctccaattacatcttcaccgcagtctttctg
gctgagatgacagtgaaggtggtggcgctgggctggtgttttggggagcaggcctacctg
cgtagcagctggaacgtgctggacgggctgctggtgctcatctccatcatcgacatcctg
gtgtccatggtctccgacagcggcaccaagatcctgggcatgctgagggtactgcggctg
ctgcggaccctgcgcccgctcagggtaatcagccgggcacaggggctgaagctggtggtg
gaaacgctgatgtcctcgctgaagcccattggcaacattgtggtcatctgttgtgccttc
ttcatcatatttggcatcctaggggtgcagctcttcaaagggaagttctttgtgtgccag
ggcgaggacaccaggaacatcacgaacaagtctgactgtgctgaggccagttaccggtgg
gtccggcacaaatacaactttgacaacctcggccaggccctaatgtccctgttcgtgctg
gcctctaaggatggctgggtggatatcatgtatgatgggctggatgctgtcggcgtggac
cagcagcccatcatgaaccacaacccctggatgctgctgtacttcatctcgttcctgctc
atcgtggccttctttgtcctgaacatgttcgttggtgtggtggtggagaacttccacaag
tgtcggcagcaccaggaggaagaggaggcccggcggcgggaggagaagcgtctacggaga
ctggagaaaaagagaaggaatctaatgctggacgatgtaattgcttccggcagctcagcc
agcgcggcgccagaagcccagtgcaaaccctactactcagactactcccgcttccggctc
ctcgtccaccacctgtgtaccagccactacctggatctcttcatcacgggtgtcattggg
ctgaacgtggtcactatggccatggagcactaccagcagccccagatcctggatgaggct
ctgaagatctgcaactatatcttcactgtcatctttgtcttggagtcagttttcaaactg
gtggcctttggctttcgacggttcttccaggacaggtggaaccagctggacctggccatt
gtgctgctgtccatcatgggcatcacactggaggagattgaggtcaatgcctcgctgccc
atcaaccccaccatcatccgcatcatgagggtgctgcgtattgcccgagtgctaaagcta
ctgaagatggctgtgggcatgcgggcactcctggacacagtgatgcaggccctgccccag
gtggggaacttgggacttctcttcatgttgttgtttttcatctttgcagctctgggcgtg
gagctctttggagatctggagtgtgatgagacgcacccctgcgagggcctgggccggcat
gccacctttcggaactttggcatggccttcttgaccctcttccgagtctccacaggtgac
aactggaatggcatcatgaaggacaccctccgggactgtgaccaggagtccacctgctac
aacacggtcatctcccccatctacttcgtttccttcgtgctgacagcccagtttgtgctg
gtcaacgtggtcattgccgtgctgatgaagcatctggaggagagcaacaaggaggccaag
gaggaggccgagctggaggctgaactggagctagagatgaagacgctcagcccacaagcc
ccctcaccactgggcagccccttcctctggcctggggtcgagggccccgacagccctggc
agccccaaacctggggccccacatgccacaccccacactggagcagcctcccgcttctcc
ctggagcaccccatggacagacagctgtttgacaccatatccctgctgatccagggctcc
ctggatggggagctgaagctgatggacgagctggcaggcccagggggccagccctctgcc
ttccctcctgcctgcagcccaggcggctccgacccacagatccctctagctgagatggag
gctctgtctttgacgtcagagattgtgtctgaactgtcctgctctctagctctgacggat
gactgtctgcctgatgacactcacacactcttacttagtgccctggcgagcaatatggag
tcccaccctgaggaggtgcccgtcatgctaggaccagatctgctgactgtgcgcaagtct
ggggtcagccgaacgcactctctgcccaatgacagctacatgtgccgggatgggagcact
gccgaggggtccctaggacacaggggctgggggctccccagagctcagtcaggctccatc
ttgtccgtccactcccagccagcagacaccagctacatcccgcagcttcccaaagatgcg
ccccatctgctccagccccatggtgctcccacctggggcaccatccccaaattgccccca
ccaggccgctcccctttggctcagaggccactcaggcgccaggcagcaatacggacggat
tccctggacattcagggcctgggcagcagggaagacctgctgtcagaggtgagtgggccc
tccccgccgctggcccgggcctcctccttttggggccactccagcacccaggctcagcag
cattcccgcagccagagcaagatcttgaagcacatgcccccgtcagccccctgcccaggc
ccagaactcaagtgggccaagggcccaccagagaccagaagcagcttagagctggacacg
gagctgagctggatttcaggagacctcctgcccacggacagtcaggaggaagccccgtct
gcacgggacctgaagaagtgctacagcgtggaggcgcagagctgcccgcgccggccggca
tcctggctggatgaacagaggaggcactccatcgcggtcagctgcctggacagtggctcc
caacccgccctgggccctgatccctcgagccttggaggtcagcctctagggggagctggg
agccggcccaagaagaaactcagcccacccagcatctccatagaccccccagagagccag
agccagggccctcggcccccacccagtcctggtgtctgcctccgccggagggctccgtcc
agcgactccaaggatcccttggcctctggccctcctgacagcatggctgcctcgccctcc
ccaaagaaagacgtgctgagtctctctggtttatcctctgacccagcagacctggacccc
tga

DBGET integrated database retrieval system