KEGG   Bos taurus (cow): 282412
Entry
282412            CDS       T01008                                 

Gene name
CACNA1H
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1H isoform X1
  KO
K04855  voltage-dependent calcium channel T type alpha-1H
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04020  Calcium signaling pathway
bta04713  Circadian entrainment
bta04925  Aldosterone synthesis and secretion
bta04927  Cortisol synthesis and secretion
bta04929  GnRH secretion
bta04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    282412 (CACNA1H)
   04020 Calcium signaling pathway
    282412 (CACNA1H)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    282412 (CACNA1H)
   04925 Aldosterone synthesis and secretion
    282412 (CACNA1H)
   04927 Cortisol synthesis and secretion
    282412 (CACNA1H)
  09159 Environmental adaptation
   04713 Circadian entrainment
    282412 (CACNA1H)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    282412 (CACNA1H)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    282412 (CACNA1H)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   282412 (CACNA1H)
SSDB
Motif
Pfam: Ion_trans PKD_channel TMEM208_SND2
Other DBs
NCBI-GeneID: 282412
NCBI-ProteinID: XP_024841196
BGD-bta: BT16533
Ensembl: ENSBTAG00000026461
VGNC: 26678
LinkDB
Position
25
AA seq 2351 aa
MTEGVQAADEVRVPLGAPAPGPAAAAASPASPGAPGPEAERGSGPSASPPESPAAERGAE
LGADEEQPVPYPALAATVFFCLGQTTRPRSWCLRLVCNPWFEHVSMLVIMLNCVTLGMFR
PCEDVECRSERCGILEAFDDFIFAFFAVEMVIKMIALGLFGQKCYLGDTWNRLDFFIVMA
GMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVF
FIFGIVGVQLWAGLLRNRCFLDSTFARNSNLSFLRPYYQPEEGEENPFICSSRRDNGMQK
CSHIPSRRELRVECTLGWEAYGQPQAEGAGGTGHHTCINWNQYYNVCRSGDSNPHNGAIS
FDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIAT
QFSETKQRENQLMREQRARYLSNDSTLASFSEPGSCYEELLRYVGHVCRKLKRRGLRLYA
RWQSRWRKKVEPGGATHGQGSGRRPRRAGGRAASIHHLVYHHHHHHHHHYHFSHGSPRRP
GPEPGAGDTRLVRAGAPASPGRGPPDAESVHSVYHADCHVEGPQERARVAHAAATAAAGL
KLATGLGAMNYPTILPSAAGSGKSGLGPKGKRPGGPPGAGGHSPLRLSSPDPCEKIQHLV
GEHGLGQAPSRLSGLSVPCPLPSPQAGTLTCELSSCPYCTSALEGPELEFSDSDSGDSDS
NGVYEFTQDVRHGDHRDPMQSPPVAEAPGVGGTRRRGPQRAVAGEQGGLGHVWASFSGKL
RRIVDSKYFNRGIMVAILTNTLSMGVEYHEQPDELTNALEISNIVFTSMFALEMLLKLLA
CGPLGYIRNPYNIFDGIIVVISVWEIIGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLV
VLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFSLKTDTGDTIPDRKNFDSLLWAIVT
VFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDATR
SDTDEDKTSTHLEEDLDKFRDLRATEMKMYSLAVTPNGHLEGRGSLPPPLIMRTAATPMP
TPKSSPHLDEAPGPLDSRRGSSSSMDPQLGDQKSLSSLRSSPCAPWGPNSAWSSRRSSWN
SLGRAPSLKRRSQCGERESLLSGEGRGSGSTDEEAEDGRPGAGASPGTRATPLRRTESLD
HRSTLDLRPPRPATLLPTKVHDCNGQVLALPSEFFLRIDSHKEDPAEFDDDVEDSCCSRL
QKVLEPHKPECCRSREPWALYLFSPQNRFRISCQKIIAHKMFDHVVLVFIFLNCITIALE
RPDIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLISGEHAYLQSSWNILDGVLVLV
SLVDIIVAMASAGGAKILGILRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIV
LICCAFFIIFGILGVQLFKGKFYYCEGADTRNISTKAECRAAHYRWVRRKYNFDNLGQAL
MSLFVLSSKDGWVNIMYDGLDAVGVDQQPVPNHNPWMLLYFISFLLIVSFFVLNMFVGVV
VENFHKCRQHQEAEEARRREEKRQRRLERKRRSTFPNPEAQRRPYYADYSPTRRSIHTLC
TSHYLDLFITFIIGVNVITMSMEHYNQPKALDEALKYCNYVFTIVFVVEAVLKLVAFGFR
RFFKDRWNQLDLAIVLLSIMGITLEEIEMNAALPINPTIIRIMRVLRIARVLKLLKMATG
MRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNF
GMAFLTLFRVSTGDNWNGIMKDTLRECAREDKHCLTYLPAISPIYFVTFVLVAQFVLVNV
VVAVLMKHLEESNKEAREDAELDAELEMEMAQGSPARPRPAAPQSPGASPDSPNVLVVRK
VSVSRMLSLPNDSYMFRPVAPAAAAHPHPLQEVEMETYAGAAAGQVTAAHSPPVESCASL
QVPSAVSSPSRGGDTLRALPPRGAARSPNVGRLLCRQEAVHTESLEGHVDGTEDSSPFWG
EPGGKTPVRQASLGPSLRSPSRSPRPSSIRTRKHTSGQHCISSRPPAPGGEESEAPDPAD
EEVSHITSSARSPLASPTACGIVGGEPDVHRLYSVDARGFLDQPGRVDEQRRPLGEPGVG
DSRPEAGEAKPRVLEAELALGARRKKKMSPPCISIEPPAEDEGAARAPAAEGGSTTLRRR
TPSCEAVPHRDPLEPADSTGLDAAAKGERRGQGPCRTEHLTVPNFTFEPLDVGSPSGDLF
TDAGHGATPEPRPSSSGTAAPPEPREMESTVPSGDPLEEGRGVHLTVPESPPKRASPPAV
PVPGDDVDEPV
NT seq 7056 nt   +upstreamnt  +downstreamnt
atgaccgagggcgtgcaggcggccgacgaggtccgcgtgcccctgggcgcgccagccccg
ggcccggcggcggcggcggcgtccccggcgagccctggggccccggggccagaggcggag
cgggggtcggggcccagtgcgtcgccccccgagagtccggcggccgagcgcggcgccgag
ctgggcgccgacgaggagcagcccgtcccgtacccggcgctggcggccaccgtcttcttc
tgtctcgggcagaccacgcggccgcgcagctggtgtctccggctggtctgtaacccgtgg
ttcgagcatgtcagcatgctggtcatcatgctcaactgcgtgaccctgggcatgttccgg
ccctgcgaggacgtcgagtgccgctcggagcgctgtggcatcctcgaggcctttgacgac
ttcatcttcgccttcttcgcggtggagatggtcatcaagatgatcgccctggggctgttt
gggcagaagtgctacttgggtgacacgtggaacaggctggacttcttcatcgtcatggcg
ggtatgatggagtactccttggacggacacaacgtgagcctctcggccatccgaaccgtg
cgcgtgctgcggccccttcgtgccatcaaccgtgtgcccagcatgcggatcctggtcacg
ctgctgctggacacactgcccatgctcggcaacgttctcctgctctgcttctttgtcttc
ttcatcttcggcatcgtgggcgtccagctttgggccggcctgctgcgcaaccgctgcttc
ctggacagcaccttcgccaggaacagcaacctcagcttcctgcggccgtactaccagccg
gaggagggcgaagaaaacccgttcatctgctcctcccgccgggacaacggcatgcagaag
tgctcgcacatccccagccgccgcgagctgcgcgtggagtgcacgctgggctgggaggcc
tacgggcagccgcaggccgagggcgcaggtggcacgggtcaccacacctgcatcaactgg
aaccagtactacaatgtgtgccgctcgggcgactccaacccgcacaacggggccatcagc
ttcgacaacatcggctacgcctggatcgccatcttccaggtgatcacgctggagggctgg
gtggacatcatgtactacgtcatggacgcccactctttctacaacttcatctacttcatc
ttgcttatcatcgtgggctccttcttcatgatcaacctgtgcctggtggtcatcgccacg
cagttctcagagacgaagcagcgggagaaccagctgatgcgggagcagcgggcccgttat
ctgtccaatgacagcacgctagccagcttctctgagccgggcagctgctatgaggagctt
ctccggtacgtgggccacgtgtgccgcaagctaaagcgccgtggcctgcgcctctacgcc
cgctggcagagccgctggcgcaagaaggtggagcccggtggcgccacgcatggccagggc
tcagggcggcggccgcggcgggcaggcgggcgcgctgcctccatccaccacctcgtgtac
caccaccaccaccatcaccaccaccactaccacttcagccacggcagcccccgccggcca
ggccccgagccaggagccggcgacactaggctggtgcgggccggagcgccagcctcaccc
gggcgcgggccccctgacgccgagtcggtgcacagtgtgtaccacgctgactgccacgtg
gaggggccacaggagagggcgcgcgtggcacacgccgcagccactgccgctgctgggctc
aagctggccaccgggctgggagccatgaactaccccaccatcctgccctcggctgcgggc
agtggcaaaagcggcctcgggcccaaggggaagcggcctggtggccccccgggagccggg
gggcacagccccctgaggctgagcagcccggacccctgcgagaagatccagcacctggtt
ggggagcatggactgggccaggcccccagccgcctgtcaggcctgagtgtgccctgcccc
ctgcccagcccccaggcgggcacgctgacctgtgagctgagcagctgcccgtactgcacc
agtgccctggagggccccgagctggagttcagcgactcagacagtggagactcagacagc
aatggggtctacgagttcacgcaggatgtgcggcacggggaccaccgcgaccccatgcag
tcgccccccgtggcagaggcgccaggcgtgggcggcacacggcggagggggccgcagcgg
gcggtggcaggcgagcagggtgggctgggccacgtctgggcctccttcagtggcaagctg
cgccgcatcgtggacagcaagtacttcaaccggggcatcatggtggccatcctcactaac
acgctgagcatgggtgtcgagtaccacgagcagcccgatgagctgaccaacgccctggag
atcagcaacattgtgttcacaagcatgtttgctctggagatgctgttgaagctgctggcc
tgcggcccactgggctacatccggaacccttacaacatctttgacggcatcatcgtagtc
atcagcgtgtgggagatcatcgggcaggcggacggcgggctgtcggtgctgcgcaccttc
cggctgctgcgggtgctcaagctggtgcgcttcatgcccgcactgcggcgccagctggtg
gtgctcatgaagaccatggacaacgtggccaccttctgcatgctgctcatgcttttcatc
ttcatcttcagcatccttggcatgcatctctttggctgcaaattcagtctgaaaacagat
accggagacacaatccccgaccggaagaactttgattccctactgtgggccatcgtcacc
gtgttccagatcctcacccaggaggactggaacgtcgtcctgtacaacggcatggcctcc
acgtcctcctgggccgccctgtacttcgtggccctcatgacctttggcaactacgtgctc
ttcaacctgctggtggccatcctggtggagggtttccaggccgagggtgatgccaccagg
tccgacacagatgaagacaagacatccacccacttggaggaggacttggacaagttccga
gacctcagggccacagagatgaagatgtactcgctggcagtgacacccaacgggcacctg
gagggccggggcagcctgccccctccccttatcatgcgcacagcggccacgcccatgccc
acccccaagagctccccacacctggacgaggcccctggccccctggactcgcgccgtggc
agcagcagctccatggaccctcagctaggagaccagaaatctctgtccagcctccgcagc
tcgccctgcgccccctgggggcccaacagcgcctggagcagccggcgctccagctggaac
agcctgggccgtgcacccagcctcaagcgcaggagccagtgtggggagcgcgagtcgctg
ctgtccggtgagggcaggggcagcggcagcactgacgaggaggccgaggatggccggccc
ggggcgggggcctcgccgggtacgcgtgccacgccgctgcggcgcaccgagtccctggac
caccgtagcacgctggacctgcggcccccacggccagccaccctgctgcccaccaaggtc
cacgactgcaacgggcaggtgctggccctgccgagcgagttcttcctgcgcatcgacagc
cacaaggaggatccggccgagtttgacgacgatgtggaggacagctgctgctcaaggctg
cagaaggtgctggagccgcataagccggagtgctgccggagccgcgagccctgggccctg
tacctcttctccccacagaacaggttccgcatctcctgccaaaagatcattgctcacaag
atgttcgatcatgtcgtcctcgtcttcatcttcctcaactgcatcaccatcgccctggag
aggcccgacatcgaccccggcagcactgagcgcgtcttcctcagcgtctccaactacatc
ttcacagcgatcttcgtggcggagatgatggtgaaggtggtggccctgggtctcatctcg
ggtgagcatgcctacctgcagagcagctggaacatactggatggggtgctggtcctggtg
tccctggtggacatcatcgtggccatggcctcggctggcggcgccaagatcctgggcatc
ctgcgtgtgctgcgcctgctgcggaccctgcggccgctaagggtcatcagccgtgcgccg
ggactcaagctggtggtggagactctgatatcgtccctcaggcccatcgggaacatcgtc
ctcatctgctgcgccttcttcatcatcttcggcatcctcggggtgcagctcttcaagggg
aagttttactactgcgagggcgccgacaccaggaacatttccactaaggccgagtgcagg
gccgcgcactaccgctgggtgcgacgcaagtacaacttcgacaacctgggccaggcgctg
atgtcgctgttcgtgctctcgtccaaggacggctgggtgaatatcatgtacgacgggctg
gacgccgtgggcgtggaccagcagcccgtgcccaaccacaacccctggatgctgctctac
ttcatctccttcctgctcatcgtcagcttcttcgtgctcaacatgttcgtgggcgtcgtg
gtggagaacttccacaagtgccggcagcaccaggaggccgaggaggcgcggcggcgcgag
gaaaagcggcagcgtcgcctggagaggaagcgcaggagcactttccctaacccagaggcc
cagcgacggccctactatgcggactactcgcccacccgccgctccatccacactctgtgc
accagccactacctggacctcttcatcaccttcatcattggcgtcaacgtcatcaccatg
tccatggagcactacaaccagcccaaggctctggacgaggccctcaagtactgcaattac
gtgttcaccatcgtctttgtcgtcgaggccgtgctgaagctggtggcctttgggttccgg
aggttcttcaaggacaggtggaaccagctggacctggccatcgttctgctgtccatcatg
ggcatcacgttggaggagatcgagatgaatgcagcgctgcccatcaaccccaccatcatc
cgaatcatgcgtgtcctccgtatcgcccgcgtcctgaagctgctcaagatggccacgggc
atgcgggccctgctggacacggtggtccaggcgctgccccaggtagggaacctcggcctg
cttttcatgctcctgttttttatctatgctgccctgggagtggagctgttcgggaggcta
gaatgcagtgaggacaacccctgcgagggcctgagcagacacgccaccttctctaacttc
ggcatggccttcctcacgctgttccgcgtgtccaccggggacaactggaacgggatcatg
aaggacacgctgcgcgagtgcgcccgcgaggacaagcactgcctcacctacctgccggcc
atctcgcccatctacttcgtcaccttcgtgctggtggcccagttcgtgcttgtcaacgtg
gtggtggccgtgctcatgaagcacctggaggagagcaacaaggaggcccgcgaggacgcc
gagctggacgcagagcttgagatggaaatggcgcaggggtcccccgcccgtcccaggccg
gcggcccctcagagccccggcgcctcgccggactcccccaacgtgctggtcgtgcgcaag
gtgtcggtgtccaggatgctatccctgcccaacgacagctacatgttccggcccgtggcg
cctgcggcagccgctcacccccacccgctacaggaggtggagatggagacctacgcgggc
gcggccgccggccaggtcaccgctgcccactcgccgcctgtggagtcctgcgcctccctc
caggttccgtccgccgtgtcctccccgtccaggggcggcgacaccctccgtgccctgccc
ccacggggtgcagcccggtcgcctaatgtcggccgacttctctgcagacaggaggccgtc
cacacggagtccctggaagggcatgtcgatggcactgaggacagcagcccattctgggga
gagcctggcgggaagacccccgtgagacaggcatccctggggccctccttgcggtcccca
tcccggtccccgcgaccctccagcatccgcacccgcaagcacacttctggacagcactgc
atctccagccggcctcctgccccaggcggggaggagtccgaagccccagacccagctgac
gaggaggtcagccacatcaccagctctgcccgcagccctttggcctcgcccactgcctgt
gggatcgtgggcggcgagccagacgtgcacaggctctacagcgtggacgcccggggcttc
ctggaccagccgggccgggtggatgagcagaggcggcccttgggggagccaggagttggg
gacagccgtccagaggccggggaggcgaagccccgggtcctggaggccgagctggcccta
ggggcgcgcaggaagaagaagatgagccccccctgcatttccatagagccccccgctgag
gacgagggtgcggccagggcccctgcggcagaaggcggcagcaccaccctgcggcggcga
accccatcctgcgaggctgtgccccatagggaccccctggagcccgcagacagcacaggg
ctggacgctgctgccaagggggagcggcggggccagggcccctgccgtacagaacacctg
actgtcccgaacttcacctttgagccactggacgtggggagccccagtggggacctgttc
acagatgcgggccatggggccaccccagaacccagaccctcctcctcaggcaccgcggcc
cctccagaaccccgggagatggagtccacagtgccctcaggagaccccctagaggagggg
cggggggtgcacctcactgtcccggagagcccaccgaagagagcgtcccccccggctgtg
ccagtcccgggtgacgacgtggatgagcccgtgtag

DBGET integrated database retrieval system