KEGG   Bos taurus (cow): 282603Help
Entry
282603            CDS       T01008                                 

Gene name
PRSS2
Definition
(RefSeq) anionic trypsin precursor
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
bta  Bos taurus (cow)
Pathway
bta04080  Neuroactive ligand-receptor interaction
bta04972  Pancreatic secretion
bta04974  Protein digestion and absorption
bta05164  Influenza A
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    282603 (PRSS2)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    282603 (PRSS2)
   04974 Protein digestion and absorption
    282603 (PRSS2)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    282603 (PRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bta01002]
    282603 (PRSS2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    282603 (PRSS2)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     282603 (PRSS2)
Peptidases [BR:bta01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   282603 (PRSS2)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   282603 (PRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 282603
NCBI-ProteinID: NP_777115
BGD-bta: BT10244
Ensembl: ENSBTAG00000021565
UniProt: Q547S4
LinkDB All DBs
Position
4
AA seq 247 aa AA seqDB search
MHPLLILAFVGAAVAFPSDDDDKIVGGYTCAENSVPYQVSLNAGYHFCGGSLINDQWVVS
AAHCYQYHIQVRLGEYNIDVLEGGEQFIDASKIIRHPKYSSWTLDNDILLIKLSTPAVIN
ARVSTLALPSACASGSTECLISGWGNTLSSGVNYPDLLQCLEAPLLSHADCEASYPGEIT
NNMICAGFLEGGKDSCQGDSGGPVACNGQLQGIVSWGYGCAQKGKPGVYTKVCNYVDWIQ
ETIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcatcccctgctgatccttgcctttgtgggagctgctgtggctttcccctcggacgac
gatgacaagatcgtcgggggctacacctgcgcggagaattctgtcccttaccaggtgtcc
ctgaatgctggctaccacttctgcgggggctccctcatcaatgaccagtgggtggtgtcc
gcggctcactgctaccagtaccacatccaggtgaggctgggagaatacaacattgatgtc
ttggagggtggtgagcagttcatcgatgcgtccaagatcatccgccaccccaagtacagc
agctggactctggacaatgacatcctgctgatcaaactctccacgcctgcggtcatcaat
gcccgggtgtccaccttggctctgcccagtgcctgtgcttccggcagcaccgagtgcctc
atctccggctggggcaacaccctgagcagtggcgtcaactacccggacctgctgcaatgc
ctggaggccccgctgctgagccacgccgactgtgaagcctcgtaccctggagagatcact
aacaacatgatctgcgctggcttcctggaaggaggcaaggattcctgccagggtgactct
ggcggccctgtggcttgcaacggacagctccagggcattgtgtcttggggctacggctgt
gcccagaagggcaagcctggggtctacaccaaggtctgcaactacgtggactggattcag
gagaccatcgccgccaacagctga

DBGET integrated database retrieval system