KEGG   Bos taurus (cow): 282608
Entry
282608            CDS       T01008                                 

Gene name
CACNA2D1
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-1 precursor
  KO
K04858  voltage-dependent calcium channel alpha-2/delta-1
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04260  Cardiac muscle contraction
bta04261  Adrenergic signaling in cardiomyocytes
bta04921  Oxytocin signaling pathway
bta05410  Hypertrophic cardiomyopathy
bta05412  Arrhythmogenic right ventricular cardiomyopathy
bta05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    282608 (CACNA2D1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    282608 (CACNA2D1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    282608 (CACNA2D1)
   04261 Adrenergic signaling in cardiomyocytes
    282608 (CACNA2D1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    282608 (CACNA2D1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    282608 (CACNA2D1)
   05414 Dilated cardiomyopathy
    282608 (CACNA2D1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    282608 (CACNA2D1)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   282608 (CACNA2D1)
SSDB
Motif
Pfam: VGCC_alpha2 VWA_N VWA VWA_3 VWA_2 dCache_1 IFN-gamma
Other DBs
NCBI-GeneID: 282608
NCBI-ProteinID: NP_001192916
BGD-bta: BT27302
Ensembl: ENSBTAG00000020569
VGNC: 26679
UniProt: A0A3Q1NFD1
LinkDB
Position
4
AA seq 1091 aa
MAAGCLLALTLTLFQSLLIGPSSEEPFPSAVTIKSWVDKMQEDLVTLAKTASGVNQLVDI
YEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASN
EVVYYNAKDDLDPEKNDSEPGSQRIKPVFIDDANFGRQISYQHAAVHIPTDIYEGSTIVL
NELNWTSALDEVFKKNREEDPSLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRR
RPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD
VSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIML
FTDGGEERAQEIFTKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIR
INTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNITGQNENKTNLK
NQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKNPKSQEPVTL
DFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSL
ALVLPTYSFYYIKAKIEETITQARSKKGRMKDSETLKPDNFEESGYTFIAPRDYCNDLKI
SDNNTEFLLNFNEFIDRKTPNNPSCNTDLINRVLLDAGFTNELVQNYWSKQKNIKGVKAR
FVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYVFTAPYFNKSGPGAYESGI
MVSKAVEIYIQGKLLKPAVVGIKIDLNSWIENFTKTSIRDPCAGPVCDCKRNSDVMDCVI
LDDGGFLLMANHDDYTNQIGRFFGEIDPSLMRHLVNISVYAYNKSYDYQSVCEPGAAPKQ
GAGHRSAYVPSIADVLHIGWWATAAAWSILQQFLLSLTFPRLLEAVEMEDDDFTASLSKQ
SCITEQTQYFFDNDSKSFSGVLDCGNCSRIFHVEKLMNTNLIFIMVESKGTCPCDTRLLI
QAEQTSDGPDPCDMVKQPRYRKGPDVCFDNNALEDYTDCGGVSGLNPSLWSIIGIQCVLL
WLLSGSRHHQL
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggctgctggctgcctgctggccttgactctgacacttttccaatctttgttgatcggc
ccctcgtcggaggagccgttcccttcggccgtcactatcaagtcatgggtggataagatg
caagaagaccttgtcaccctggcaaaaacagcaagtggagtcaatcagcttgtcgatatt
tatgagaaataccaagatttgtatactgtggagccaaataatgcacgtcagctggtggaa
attgcagccagggatattgaaaaacttctgagcaacagatccaaagccctggtgcgtcta
gctttggaagcagagaaagttcaagcagcccaccagtggagagaggatttcgcaagcaat
gaagttgtgtactacaatgcaaaggatgatcttgatccagaaaagaatgatagtgaacca
ggcagccagaggataaaacctgtttttatcgatgatgctaattttgggcgacaaatatcc
tatcagcacgcagccgttcatattcccactgacatctatgagggctcaacaattgtatta
aatgaactcaactggacaagtgccttagatgaagttttcaagaaaaatcgagaagaagat
ccttcattattgtggcaggtgtttggcagtgccacaggcctggcccgatattatccagct
tctccatgggttgataacagtagaactccaaacaaaattgacctttatgatgtacgcagg
agaccatggtacatccaaggagctgcatctcctaaagacatgcttattctggttgatgtg
agtgggagtgttagtggtttgacacttaaactgatccgaacatctgtctccgaaatgttg
gaaaccctctcagatgacgattttgtgaatgtagcttcatttaacagcaatgcccaggat
gtaagctgttttcagcaccttgtccaagcaaatgtgagaaataagaaagtgctgaaagat
gcagtgaataatatcacagcaaaaggaatcacagattataagaagggatttagttttgct
tttgaacagctgcttaattataatgtgtctagagccaactgcaataagattatcatgttg
ttcacggatggaggagaagagagagctcaggagatatttaccaaatacaacaaagacaaa
aaggtccgtgtattcacattttcagttggtcaacataattatgacagaggacctattcag
tggatggcctgtgaaaataaaggttattattacgaaattccttccattggagcaataaga
atcaatactcaggaatatttggatgttctgggaagaccaatggttttagctggagacaaa
gctaagcaagtccagtggacaaacgtatacctggatgcactggaactgggacttgtcatt
actggaactcttccggtcttcaacataaccggccaaaatgaaaataagacaaacttaaag
aatcagctgattcttggtgtgatgggagttgatgtgtccttggaagatattaaaagacta
acaccacgttttacattgtgccccaatggctattattttgcaattgatcctaatggttat
gttttattacatccaaatcttcagccaaagaaccccaaatctcaggagccagtaactttg
gatttccttgatgcagaattagagaacgatattaaagtggagattcgaaataaaatgata
gatggagaaagcggagaaaaaacattcaggactctggttaaatctcaagatgagagatat
attgacaaaggaaacaggacatatacatggactcctgtcaatggcacagattacagtttg
gccttggtattaccaacctacagtttttactatataaaagccaaaatagaagagacaata
actcaggccagatccaaaaagggcagaatgaaggattcagaaactctgaaaccggataat
tttgaagagtctggctatacgttcatagcaccaagagattactgcaatgaccttaaaata
tcagataataacaccgaatttcttttaaattttaatgagtttattgatagaaaaactcca
aacaacccatcatgcaacacagacttgattaatagagtcttgctggatgcaggctttaca
aatgaacttgtccaaaattactggagtaagcagaaaaacatcaagggagtgaaagcacga
tttgttgtgactgatggtgggattaccagagtttatccgaaagaggctggagaaaattgg
caagaaaacccagaaacatatgaggacagcttctataaaagaagtctagataacgataac
tatgttttcactgctccctactttaacaaaagtggacctggtgcttatgaatcaggcatt
atggtaagcaaagctgtagaaatttacatccaaggaaaacttcttaaacctgcagttgtt
ggaattaaaattgatctaaattcctggatagagaatttcaccaaaacatcaatcagggat
ccgtgtgcgggtccagtttgtgactgtaaaagaaacagtgatgtaatggactgtgttatt
ctagatgatggtgggttccttttgatggcaaatcatgatgattatactaaccagattgga
agattttttggagagattgatccaagtttgatgagacacctggttaatatatcagtttat
gcttataacaagtcttatgattatcagtcggtgtgtgagccaggagctgcaccaaaacaa
ggagcagggcatcgctcagcatacgtgccatcaatagccgacgtattacacattggctgg
tgggccactgctgctgcctggtctattctacagcagtttctcttgagtttgacctttcca
cgacttcttgaggcagttgagatggaagatgatgactttacggcctctctgtcaaagcag
agttgcattactgaacaaactcagtattttttcgataatgacagtaaatcatttagtggt
gtattagattgtggaaactgttccagaatcttccatgtagaaaaacttatgaacaccaac
ttaatattcataatggttgagagcaaaggaacttgtccctgtgacacacggttgctcata
caagcagagcagacttctgatggtccagatccttgtgatatggtgaagcaacccagatac
cgaaaagggcctgatgtctgctttgataacaatgctttggaggactataccgactgtggt
ggtgtctctggattaaacccctccctgtggtccatcatcggcatccagtgtgtgctactt
tggctcttatctggcagcagacaccaccagttatga

DBGET integrated database retrieval system