KEGG   Bos taurus (cow): 282876
Entry
282876            CDS       T01008                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
bta  Bos taurus (cow)
Pathway
bta00220  Arginine biosynthesis
bta00330  Arginine and proline metabolism
bta01100  Metabolic pathways
bta04020  Calcium signaling pathway
bta04066  HIF-1 signaling pathway
bta04146  Peroxisome
bta04371  Apelin signaling pathway
bta04926  Relaxin signaling pathway
bta05010  Alzheimer disease
bta05014  Amyotrophic lateral sclerosis
bta05022  Pathways of neurodegeneration - multiple diseases
bta05133  Pertussis
bta05140  Leishmaniasis
bta05142  Chagas disease
bta05145  Toxoplasmosis
bta05146  Amoebiasis
bta05152  Tuberculosis
bta05200  Pathways in cancer
bta05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    282876 (NOS2)
   00330 Arginine and proline metabolism
    282876 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    282876 (NOS2)
   04066 HIF-1 signaling pathway
    282876 (NOS2)
   04020 Calcium signaling pathway
    282876 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    282876 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    282876 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    282876 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    282876 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    282876 (NOS2)
   05014 Amyotrophic lateral sclerosis
    282876 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    282876 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    282876 (NOS2)
   05152 Tuberculosis
    282876 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    282876 (NOS2)
   05145 Toxoplasmosis
    282876 (NOS2)
   05140 Leishmaniasis
    282876 (NOS2)
   05142 Chagas disease
    282876 (NOS2)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     282876 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 282876
NCBI-ProteinID: NP_001070267
BGD-bta: BT15434
Ensembl: ENSBTAG00000006894
VGNC: 32173
UniProt: Q27995
LinkDB
Position
19
AA seq 1156 aa
MACPWQFLFKIKSQKVDLATELDINNNVGKFYQPPSSPVTQDDPKRHSPGKHGNESPQPL
TGTVKTSPESLSKLDAPPSACPRHVRIKNWGSGVTFQDTLHQKAKGDLSCKSKSCLASIM
NPKSLTIGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHVRYATNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVLPLVLQADGRDPELFEIPPDLVLEVPMEHPRYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEVGVRDFCDAQRYNILEEVGRRMGLETHKVASLWKDRAVVEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEM
LNYVLSPFYYYQVEPWKTHVWQDERRRPQRREIRFKVLVKAVFFASVLMHKAMASRVRAT
ILFATETGRSETLAQDLGALFSCAFNPKVLCMDQYQLSHLEEEQLLLVVTSTFGNGDSPG
NGEKLKKSLLMLKELTNTFRYAVFGLGSSMYPQFCAFAHDIDQKLSQLGASQLAPTGEGD
ELSGQEEAFRSWAVQTFKAACETFDVSGKHHIEIPKLYTSNVTWDPQHYRLVQDSEPLDL
NKALSSMHAKHVFTMRLKSQQNLQSPKSSRTTLLVELSCEGSQAPSYLPGEHLGVFPCNQ
PALVQGILERVVDGPAPHQPVRLETLCENGSYWVKDKRLPPCSLSQALTYFLDITTPPTQ
LLLRKLAQLATEEAEKQRLETLCQPSDYNKWKFTNSPTFLEVLEEFPSLRVSASFLLSQL
PILKPRYYSISSSRDLTPTEIHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCF
VRSASGFQLPEDRSRPCILIGPGTGIAPFRSFWQQRLHEAEHKGLQGGRMTLVFGCRRPE
EDHLYWEEMLEMARKGVLHEVHTAYSRLPDQPKVYVQDILRQRLAGEVLRVLHEEQGHLY
VCGDVRMARDVARTLKQLMATALSLNEEQVEDYFFQLKNQKRYHEDIFGAVFPYEVKKDG
AAGLPSNPRAPGAHRS
NT seq 3471 nt   +upstreamnt  +downstreamnt
atggcctgtccctggcagtttctgttcaaaatcaaatcccaaaaggtggacttggctacg
gaactggacatcaacaacaatgtgggaaaattctaccagcccccgtccagtccagtgaca
caggatgaccccaaacgtcacagcccgggcaagcacgggaatgagtctccccagcccctc
acggggacagtaaagacgtctccagaatccctgagcaagctggacgcgcccccgtcagcc
tgtccacggcatgtgaggatcaaaaactggggcagcggagtgactttccaagacacgctt
caccagaaggccaaaggggatctctcttgcaagtccaagtcttgcctggcatccatcatg
aaccccaaaagtttgaccataggaccccgggacaagccaacccccccagacgagcttcta
cctcaagctatcgaatttgtcaaccagtattacggctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcagtaacaaaggagatagaaacaacaggaacctaccag
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaacgccccccgctgc
atcggaaggatccagtggtcgaacctgcaggtctttgacgcccggagctgttccacggcc
caggaaatgttcgaacacatctgcagacacgtgcgttatgccaccaacaacggcaacatc
aggtcggccatcactgtgttcccccagcggagcgatgggaagcatgacttccgggtctgg
aacgcccagctcatccgctatgccggctaccagatgccagatggcagcatcagaggggac
cccgccaacgtggagttcacacagctgtgcatcgacctgggctggaagcccaagtacggc
cgcttcgacgtgttgcctctagtcctgcaggctgacggccgtgacccagagctcttcgaa
atcccccctgaccttgttctcgaggtgcccatggaacatcccaggtacgaatggttccgg
gagctggagctcaagtggtacgccctgccagccgtggccaacatgctgcttgaggtgggc
ggcctcgagttcccagggtgccccttcaacgggtggtacatgggcacagaagttggagtc
cgggacttctgcgacgcccagcgatacaacatcctggaggaagtgggcagaaggatgggc
ctggaaacgcacaaggtggcctcactctggaaggaccgggctgtcgttgagatcaacgtc
gctgtgctccacagtttccagaagcagaacgtgaccatcatggaccaccactccgctgca
gagtccttcatgaagtacatgcagaatgagtaccgctcccgagggggctgcccagctgac
tggatttggctggtccccccgatctctggaagcatcacccccgtgttccaccaggagatg
ttaaattacgtcctgtcccctttctactactaccaggtggagccctggaaaacccacgtc
tggcaggacgagaggcggagaccccagagaagagaaattcgattcaaagtcttggtcaaa
gccgtgttcttcgcctcggtgctgatgcataaggccatggcatcccgggtcagagccacg
atcctctttgcaacagagacggggagatcggaaacgctggcccaggacctgggggctttg
ttcagctgtgccttcaaccccaaggttctctgcatggatcagtaccagctgagccatctg
gaggaggarcagctgctgctggtggtgaccagcacttttggcaacggagactcccctggc
aacggagagaaactgaagaagtccctcttgatgctgaaagaactcaccaacacgttccgg
tacgccgtgtttggccttggctccagcatgtaccctcagttctgcgcttttgctcatgac
attgaccagaagttgtcccagctgggggcttctcagcttgccccaaccggggaaggggac
gaactcagcgggcaggaggaggcctttcgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagacattcgatgtcagcggcaagcaccacattgagatccccaagctctacacttcc
aatgtgacctgggacccgcagcactacaggctcgtgcaggactcagagcctctggacctc
aacaaagccctgagcagtatgcacgccaagcatgtgttcaccatgaggctcaaatcgcag
cagaatctgcagagtccgaaatccagccgcaccaccctcctggtggaactctcctgtgag
ggcagccaagctccaagctacctgccgggagagcacctcggagttttcccatgcaaccag
ccggccctggttcaaggcatccttgagcgagtggtggatggccctgccccgcaccagcct
gtgcgcctggagaccctctgtgagaatggcagctattgggtcaaggataagcggctgcca
ccttgctcactcagccaggctctcacctatttcctggacatcaccaccccgccaacccag
ctgctgctccgaaagctggcccagctggccacagaagaggctgagaagcagaggctggag
accctatgccagccctcagattacaacaagtggaagttcaccaacagccccacatttctg
gaggtgctggaggagttcccgtccctgcgggtgtctgccagcttcctgctctcccagctc
cctattctgaagccccggtactactccatcagctcctccagggacctcacacccacggag
atccacctcactgtggccgtgctcacgtaccgcacccgagatggccaaggtcccctgcac
catggtgtctgcagcacgtggctcagcagcttgaagccccaagacccggtgccctgcttt
gtgcgaagtgccagyggcttccagcttcccgaggaccgctcccgtccttgcatcctcatt
gggcccggcacgggcatcgcccccttccgcagtttctggcagcagcggctccatgaggct
gagcacaaagggctccagggcggccgcatgaccctggttttcgggtgccgccgcccagaa
gaggaccacctctactgggaggagatgctggagatggcccgcaagggggtgctgcacgag
gtgcacaccgcctattcccgcctgcctgaccagcccaaggtctatgttcaagacatcctg
cggcagcggctggcgggcgaggtgcttcgcgtgctccatgaggagcaaggtcacctctat
gtctgtggggatgtgcgcatggcccgggacgtggcccgcaccctgaagcagctgatggct
actgcgctgagcctgaacgaggaacaggtggaggactatttcttccagctcaagaaccag
aagcgctatcatgaagacatctttggtgctgtatttccctatgaggtgaaaaaggatggg
gcagcagggctgcccagcaatcccagagctccaggcgcccacagaagttaa

DBGET integrated database retrieval system