KEGG   Bos taurus (cow): 286800
Entry
286800            CDS       T01008                                 

Gene name
CACNG2
Definition
(RefSeq) voltage-dependent calcium channel gamma-2 subunit
  KO
K04867  voltage-dependent calcium channel gamma-2
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04260  Cardiac muscle contraction
bta04261  Adrenergic signaling in cardiomyocytes
bta04921  Oxytocin signaling pathway
bta05410  Hypertrophic cardiomyopathy
bta05412  Arrhythmogenic right ventricular cardiomyopathy
bta05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    286800 (CACNG2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    286800 (CACNG2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    286800 (CACNG2)
   04261 Adrenergic signaling in cardiomyocytes
    286800 (CACNG2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    286800 (CACNG2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    286800 (CACNG2)
   05414 Dilated cardiomyopathy
    286800 (CACNG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    286800 (CACNG2)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   286800 (CACNG2)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 286800
NCBI-ProteinID: NP_001071300
BGD-bta: BT12254
Ensembl: ENSBTAG00000010865
VGNC: 26687
UniProt: A0JNG9
LinkDB
Position
5
AA seq 323 aa
MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH
SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL
CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF
YFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSS
SRSTEPSHSRDASPVGIKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVH
NCIQKENKDSLHSNTANRRTTPV
NT seq 972 nt   +upstreamnt  +downstreamnt
atggggctgtttgatcgaggtgttcaaatgcttttaaccacggttggtgctttcgctgcc
ttcagtctgatgaccattgctgtgggaaccgactattggctctactccagaggggtttgc
aagaccaaaagtgtcagtgagaatgaaaccagcaaaaagaacgaggaagttatgacccat
tctggattatggagaacctgctgcctagaagggaacttcaaaggtctctgcaagcaaatc
gatcacttcccagaggatgcagattatgaagctgacacagcagaatatttcctccgggct
gtgagggcctcgagcatcttcccgatcctgagtgtgattctgctcttcatgggtggactc
tgcatcgcagccagcgagttctataagactcgacacaacatcatcctgagtgccggcatc
ttcttcgtgtctgcaggtctgagtaacatcattggcattatagtgtacatatctgccaat
gccggagacccctccaagagcgactccaaaaagaatagttactcctacggctggtccttc
tacttcggggccctgtccttcatcatcgccgagatggtcggggtgctggccgtgcacatg
tttatcgaccggcacaaacagctgcgggccacagcccgcgccacggactacctccaggcc
tccgccatcacccgcatccccagttaccgctaccgctaccagcgccgcagccgctccagc
tcgcgctccaccgagccctcacactccagggacgcctcccccgtgggcatcaagggcttc
aacaccttgccgtccacggagatctccatgtacaccctcagcagggaccccctgaaggcc
gctaccacgcccaccgccacctacaactccgacagggataacagcttcctccaagttcac
aactgtatccagaaggagaacaaagactctctccactccaacacagccaaccgcaggacc
acccctgtatga

DBGET integrated database retrieval system