KEGG   Bos taurus (cow): 286840Help
Entry
286840            CDS       T01008                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial precursor
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00020  Citrate cycle (TCA cycle)
bta00190  Oxidative phosphorylation
bta01100  Metabolic pathways
bta01200  Carbon metabolism
bta04714  Thermogenesis
bta04932  Non-alcoholic fatty liver disease (NAFLD)
bta05010  Alzheimer disease
bta05012  Parkinson disease
bta05016  Huntington disease
Module
bta_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bta_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bta_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    286840 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    286840 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    286840 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    286840 (SDHB)
   05012 Parkinson disease
    286840 (SDHB)
   05016 Huntington disease
    286840 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    286840 (SDHB)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     286840 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-GeneID: 286840
NCBI-ProteinID: NP_001035573
BGD-bta: BT27935
Ensembl: ENSBTAG00000008314
VGNC: 34391
UniProt: Q3T189
LinkDB All DBs
Position
2
AA seq 280 aa AA seqDB search
MAAVVALSLRRRFPAAALGGARLQACRGAQTAAAAAPRIKKFAIYRWDPDKTGDKPHMQT
YEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQGGKEQYLQSIEDREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKQASA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagtggtcgcgctctccttgaggcgccggttcccggccgccgccctcggcggg
gcccgcctgcaggcctgccgtggggctcagacagctgcagccgcagcaccccgaatcaag
aaatttgccatctatcgatgggacccggacaagactggagacaaacctcacatgcaaact
tatgagattgatttgaataactgtggtcctatggtgctggatgctctaatcaagattaag
aatgaaattgattccaccctgaccttccggagatcatgcagagaaggcatctgcggctcc
tgtgccatgaacatcaacggaggcaacactctggcgtgcacccgcaggatcgacaccaac
ctcagcaaagtttccaaaatctaccctctgccacacatgtatgtgataaaggaccttgtt
cctgatttgagcaacttctatgctcagtacaagtccatcgagccttacttaaagaagaag
gatgagtcccagggaggcaaggagcagtatctgcagtccatagaagaccgtgagaaactg
gacgggctctatgagtgtatcctctgcgcctgctgcagcaccagctgcccgagctactgg
tggaacggagacaagtacctgggccccgccgtgctcatgcaggcctatcgctggatgatc
gactccagagacgacttcacggaggagcgcctggccaagctgcaggaccccttctctctc
taccgctgccacaccatcatgaactgcacgcagacctgccccaaggggctgaatcctggg
aaagctattgctgaaatcaagaagatgatggcaacctataaagagaagcaggcttctgct
taa

DBGET integrated database retrieval system