KEGG   Bos taurus (cow): 327703
Entry
327703            CDS       T01008                                 

Gene name
CACNB1
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit beta-1
  KO
K04862  voltage-dependent calcium channel beta-1
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04260  Cardiac muscle contraction
bta04261  Adrenergic signaling in cardiomyocytes
bta04921  Oxytocin signaling pathway
bta05410  Hypertrophic cardiomyopathy
bta05412  Arrhythmogenic right ventricular cardiomyopathy
bta05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    327703 (CACNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    327703 (CACNB1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    327703 (CACNB1)
   04261 Adrenergic signaling in cardiomyocytes
    327703 (CACNB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    327703 (CACNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    327703 (CACNB1)
   05414 Dilated cardiomyopathy
    327703 (CACNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    327703 (CACNB1)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   327703 (CACNB1)
SSDB
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N SH3_1 SH3_2
Other DBs
NCBI-GeneID: 327703
NCBI-ProteinID: NP_787013
BGD-bta: BT23869
Ensembl: ENSBTAG00000002036
VGNC: 26683
UniProt: Q9MZL7
LinkDB
Position
19
AA seq 598 aa
MVQKTSMSRGPYPSSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSA
ESYTSRPSDSDVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVP
VQGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNR
LSSSKSGDNSSSSLGDVVTGTRRPTPPASAKQKQKSTEHVPPYDVVPSMRPIILVGPSLK
GYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKHIIIERSNTRSSLA
EVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRG
KSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPSSTPP
NPLLNRTMATAALAASPAPVSNLQGPYLASGDQSLERATGEHASVHEYPGELGQPPGLYP
SSHPPGRAGTLRALSRQDTFDADTPGNRNSAYTELGDSCVDMETDPSEGPGLGDPAGGST
PPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
NT seq 1797 nt   +upstreamnt  +downstreamnt
atggtccagaagaccagcatgtcccggggcccttacccatcctcccaggagatccccatg
gaggtcttcgaccccagcccacagggcaaatacagcaagaggaaagggcggttcaaaagg
tcggatgggagcacatcctcggatacaacatccaacagctttgtccgccagggctcagca
gagtcctacaccagccgtccgtcagactctgatgtgtctctggaggaggaccgggaagcc
ttaaggaaggaggcagagcgtcaggcgttagcccagctagagaaagccaagaccaagccg
gtggcatttgctgtgcggacaaatgtcggctacaacccatctccaggggatgaggtgcct
gtgcagggagtggccatcaccttcgagcctaaggacttcctacacatcaaagagaaatac
aataatgactggtggatcgggcgactggtgaaggagggctgtgaggttggcttcatcccc
agccctgtcaaactggacagcctgcgcctgctgcaggaacagaagctgcgccagaaccgc
ctcagctccagcaaatcaggtgacaactccagctccagcctgggagacgtggtgactggc
acccgccgccccacgccccctgccagtgccaaacagaagcagaagtcgacagaacacgtg
cccccttatgacgtggtaccttccatgaggcccattatcctggtgggaccgtcgctgaag
ggctatgaggttacagatatgatgcagaaagctttatttgacttcttgaagcatcggttt
gatggcaggatctccatcacacgtgtgacagcggacatttccctggctaagcgatcagtc
ctcaacaaccccagcaaacacatcatcatcgagcgttccaacacacgctccagcctggct
gaggttcagagcgagatcgagcggatctttgagctagcccgaacccttcagttggttgct
ctggacgccgacaccatcaaccatccagcccagctctccaagacctcactggcccccatc
attgtttacatcaagatcacctctcctaaggttcttcagaggctcatcaagtctcgaggg
aagtctcagtccaaacacctcaacgtccaaatagcggcctcagagaaactggcgcagtgt
ccccctgagatgtttgacatcatcctggatgagaaccaattggaggacgcctgcgagcac
ttggcagagtacttggaagcctattggaaggctacacacccgcccagcagcactccgccc
aatccgctgctgaaccgcaccatggctactgcagccctggctgccagccctgcccctgtc
tccaacctccagggaccctaccttgcttccggggaccagtcgctggaacgggccacgggg
gagcacgccagtgtgcacgagtacccgggagagctgggccagcccccaggcctttacccc
agcagccacccgccaggccgggcgggcaccctgcgggcactgtcccgccaagacacgttt
gatgctgacacccctggcaaccgaaactctgcctacacggagctgggagactcgtgtgtg
gacatggagactgacccctccgaggggccagggcttggagaccctgcagggggcagcacc
ccaccagcccgacagggatcctgggaggatgaggaagaagactatgaagaggagctgacc
gacaaccggaaccgcggccggaataaggcccgctactgcgcggagggcgggggcccagtt
ctggggcgcaacaagaacgagctggagggttgggggcggggtgtctacatccgctga

DBGET integrated database retrieval system