KEGG   Bos taurus (cow): 353113
Entry
353113            CDS       T01008                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04020  Calcium signaling pathway
bta04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    353113 (CACNA1E)
   04020 Calcium signaling pathway
    353113 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    353113 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    353113 (CACNA1E)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   353113 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel DPBB_1
Other DBs
NCBI-GeneID: 353113
NCBI-ProteinID: NP_001178052
BGD-bta: BT29649
Ensembl: ENSBTAG00000020887
VGNC: 26675
LinkDB
Position
16
AA seq 2268 aa
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMARDSSDEHCVDISSVGTPLARASIKSAKVDGASYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLSAHPSLYRRPRAIEGLALGL
GLEKCEEERVSRGGSLKGDGGDLASALDSQRSPLALGKREPPWLARPCHGNCDPTQPEAG
SGETVVTFGDRARHRQSQRRSRHRRVRTEGREPSSTSRSRSASQERSLDEAVPSEGERDR
EPRAGHGGKEPMIQEEERERCQDLRRTNSLMVPRGSGLAGALDEADTPLVPPQPELEVGK
DAALTEQEPEGSSEQALLGDVKLDIGRVSQSEPDLSCVTANTDKATTESTSVTVTIPDVG
PLVDSTVVHISNKTDGEASPLKEAEIREDEEEVEKKQQKKEKRETGKAMVPHSSMFIFST
TNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFT
FEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLR
VLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYC
TDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVL
QHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECS
LEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMK
YYSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEII
LTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLF
FIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGC
EPDTTAPSGQSESERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGP
HHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVA
EDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMP
KASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKAL
PYLQQDPVPGLSGRSAYPSMSPLSPQEIFQLACMDPADDGQFQERQSLVVTDPSSMRRSF
STIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGR
ERGRSKERKHLLSPDVSRCNSEERGTQADWESPERHQSRSPSEGRSQTPNRQGTGSLSES
SIPSVSDSSTPRRSRRQLPPVPPKPRPLLSYSSLIRHAGSISPPADGSEGGSPLTSQALE
SNDAGLPESSNPRQGHPSPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNT
IGSAPPLRHSWQMPNGHYRRRRRGGPGPGTTCGAVSDLLSDTEEDDKC
NT seq 6807 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggccggggtcgggcgatggagactcggac
cagagcaggaaccggcaaggaacccccgtgccggcctccgggccggcggccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccctattcccgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tacgccaagaagctcatcgattggccgccgtttgagtacatgatcttggccaccatcatt
gccaattgcatcgtcttggccctggagcaacatcttcctgaggatgacaagaccccaatg
tcccgcagactggagaagacagaaccctatttcattgggatcttttgctttgaagctggg
atcaaaatcgtggccctggggttcatcttccataagggatcatacctccgcaatggttgg
aatgtcatggacttcatcgtggtcctcagtggcatcctggctactgcgggaacccacttc
aacacccatgtggacctgaggaccctccgggccgtgcgtgtcctgaggcccctgaagctc
gtgtcggggatacctagcctacagattgtgttgaaatccatcatgaaggccatggtgcct
ctcctgcagattggccttctgctcttctttgccatcctgatgtttgctatcatcggcttg
gagttctacagtggaaagttgcaccgagcgtgcttcatgaacaattcaggtattctagaa
ggatttgacccccctcacccatgtggcgtgcagggctgcccagctggttatgaatgccgg
gactggatcggccccaatgatgggatcacccagtttgataacatcctttttgccgtgctg
accgtcttccagtgtatcaccatggaagggtggaccactgtgctgtacaataccaatgat
gccttaggagccacctggaattggctgtacttcatccccctcatcatcattggatccttc
tttgttctcaaccttgtcctgggagtgctttctggggaatttgccaaagagagagagaga
gtggagaaccggagagccttcatgaaactgcggcgccagcagcagatcgagcgtgagctt
aacgggtaccgcgcctggatagacaaagcagaggaagtcatgcttgctgaagaaaacaaa
aatgctggaacgtcagccttagaagtgcttcggagggcaaccatcaaaaggagccggacc
gaggccatggcacgggactccagcgatgagcactgcgtggacatctcctctgtgggcaca
cctctcgcccgagccagcatcaagagcgccaaggtggacggggcctcctatttccggcac
aaggagcgacttttgcggatctctatccgccacatggttaagtcccaggtgttctactgg
atcgtgctgagcctggtggctctcaacaccgcctgtgtggccatcgtccaccacaaccag
ccccagtggctcacccacctcctctactatgcagagtttctgtttctggggctcttcctt
ctagagatgtccctgaagatgtacggcatggggcctcgcctttattttcactcttccttc
aactgctttgactttggggtcacagtgggcagcatctttgaagtagtctgggccatcttc
agacctggtacatctttcggaatcagtgtcctgcgagctctccggcttctaagaatattt
aaaataaccaagtattgggcatccctccggaatttggtggtctccttgatgagttccatg
aagtctatcatcagtttactcttcctccttttcctcttcattgttgtctttgctctgcta
ggaatgcagctgtttgggggcaggttcaactttaatgatgggactccttccgcaaacttt
gacaccttccctgcagccatcatgactgtattccagatcctgacgggtgaggactggaat
gaggtgatgtacaacgggatccgctcccagggtggggtcagctcgggcatgtggtctgcg
atctatttcattgtgcttaccttgtttggaaactacacactgctgaatgtgttcttggcc
atcgctgtggacaatctggccaacgcccaggagctgaccaaggatgaacaagaagaagag
gaggccttcaaccagaagcatgcactgcagaaggccaaggaggtcagcccgatgtctgca
cccaacatgccttccatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgagggagcggaggcgccggcatcacatgtccgtgtgggagcag
cgaaccagccagttgaggaggcacatgcagatgtccagccaggaggccctcaacaaggag
gaggccccgcccatgaaccccctcaaccccctcaacccgctgagccccctcaacccgctc
agcgcgcaccccagcctctaccggagaccccgggccatcgaggggctagccctgggcctg
gggctggagaagtgtgaggaagagcgcgtcagccgtggggggtccctcaaaggggatgga
ggggacttggcgagcgccctggacagccagaggagccccctggccctgggcaaacgggag
ccaccctggctggcccggccctgtcacgggaactgtgacccgacccagccggaggcgggc
agtggggagacggtggtgaccttcggggaccgggcccggcacaggcagagccagcggcgc
agccggcaccgccgcgtcaggaccgagggcagggagccctcctccacctccagaagcagg
tctgccagccaggagcggagtctggacgaagctgtgcccagcgagggggagagggaccgt
gagcccagggctggccatgggggcaaagaacccatgatccaggaggaagagcgagagcga
tgccaggacttacggaggaccaacagtctgatggtgcccagaggctccgggctggcagga
gccctggatgaggccgacacaccccttgtcccaccccagccggagctggaagtggggaag
gacgcagccctgacggagcaggagccggagggcagcagtgagcaggctctgctgggggac
gtgaagctggacataggccgggtcagccagagcgagcccgacctctcctgcgtcacggcc
aacacggacaaggccaccaccgagagcaccagcgtcactgtcaccatccccgacgtgggc
cccttggtggactcaaccgtggtgcacatcagcaacaagactgatggagaagccagtccc
ttgaaagaggcagagatcagagaggatgaggaggaggtggagaagaagcagcagaagaag
gagaagcgtgagacgggcaaggccatggtgccccacagctcgatgttcatcttcagcacc
accaacccgatccgcagggcctgccactacatcgtgaacctgcgctacttcgagatgtgc
atcctcctggtgatcgcagccagcagcatcgccctggcggccgaggaccccgtcctgacc
aactcagagcgcaacaaagtgctgaggtattttgactatgtgttcactggcgtgttcacc
tttgagatggttataaagatgatagaccagggcttgattctgcaggacggctcctacttc
cgagacctgtggaacatcctggacttcgtggtggtggttggcgcattggtggcctttgct
ctggcgaatgctttgggaactaacaagggccgggatattaagaccatcaagtccctgagg
gttctccgtgtcctgaggccgctgaagaccatcaagcgcctgcccaagctcaaggctgtc
tttgactgtgtggtcacctccttgaaaaacgtcttcaacatactcattgtctacaagctc
ttcatgttcatctttgctgtcatcgcagttcagcttttcaagggcaagttcttctactgc
acggacagttccaaggacacagagaaggagtgcataggcaactatgtagatcacgagaaa
aacaagatggaggtgaaaggccgagagtggaagcgccatgaattccattatgacaacatc
atctgggctctgctgaccctcttcactgtctccacaggggaagggtggcctcaggtcttg
cagcactcggtcgatgtgacagaggaagaccgaggcccaagccgcagcaaccggatggag
atgtccatcttttatgtggtctactttgtggtcttccccttcttctttgtcaacatcttt
gtggctctcatcatcatcaccttccaggagcaaggggacaagatgatggaagagtgcagc
ctggagaagaatgagagggcatgcatcgacttcgccatcagcgccaaaccgctcacccgc
tacatgccccagaacaggcacaccttccagtaccgcgtctggcacttcgtggtgtctcca
tcctttgagtacaccatcatggccatgatcgccctgaacaccgtcgtgctgatgatgaag
tactactctgctccctgtacctatgagctggccctgaagtacctaaatatcgccttcacc
atggtgttttccctggaatgtgtcctgaagatcattgcatttggcttcttgaactatttc
cgagacacctggaatatctttgacttcatcactgtgattggcagtatcacagaaattatt
ctgacggacagcaagctggtgaacactagtggcttcaacatgagctttctgaagctcttc
cgagcggcccgcctcatcaagctgctgcgtcagggctacaccatccgcattttactgtgg
accttcgtgcagtcctttaaggcccttccctatgtctgccttctgatcgccatgcttttc
ttcatctatgccatcattgggatgcaggtctttggaaacataaagttagatgaggagagt
cacatcaaccggcacaacaacttccggagtttctttgggtccctcatgctgctcttcagg
agtgccacgggtgaggcctggcaggagataatgctgtcgtgtctcggggagaagggctgt
gagcccgacaccactgcgccgtcggggcagagcgagagcgagcgctgtggcaccgacctg
gcctacgtgtacttcgtctccttcatcttcttctgctccttcctgatgctcaacctgttc
gtggctgtcatcatggacaactttgagtacctgactcgggactcgtccatcctggggcct
caccatctggacgagtttgtccgagtctgggcagagtatgacagagcagcatgtggccgc
atccattacactgagatgtatgaaatgctgactctcatgtcaccgccgctaggcctcggc
aagagatgtccctccaaggtggcatataagaggttggtcttgatgaacatgccagtggcc
gaggacatgaccgtccacttcacttccacgctgatggctctaatccggacagctctggac
attaaaatcgccaaaggcggtgcagacaggcagcagctagactcagagctccagaaggag
accctggccatctggcctcacctgtcccagaagatgctggatctgctcgtgcccatgccc
aaagcctctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggactactac
aaacagagcaaggtgaagaagcagaggcagcagctggaggaacagaaaaacgcacccatg
ttccagcgcatggagccctcgtctctgcctcaggagatcatcgctaatgccaaagccctg
ccttatctccagcaggaccccgttccaggcctgagtggccggagtgcatacccttcgatg
agtccactctccccgcaggaaatattccagttggcctgtatggacccagctgatgatgga
cagttccaggaacgacaatctctggtggtgacagaccccagctccatgagacgttcattt
tccaccattcgcgataagcgttcaaattcctcgtggctggaggaattctccatggagcga
agcagcgaaaacacctacaagtcccggcgccggagttaccactcctccctgaggctgtca
gcccaccgtctgaactcggactcaggccacaagtccgacacccaccgctcagggggcaga
gagcggggacgatcgaaagagcgaaagcatcttctctctcctgacgtctcccgctgcaac
tccgaggagcgagggacccaggccgactgggagtccccagagcgccatcagtcccggtct
cccagtgaaggcaggtcacagacccccaacagacagggcacggggtccctgagtgagagc
tccatcccctctgtctccgactccagcaccccacgacgaagtcggcggcagctcccccca
gtccctcccaagcctcggcccctcctttcctacagctctctgatcagacacgctgggagc
atctccccaccagctgatgggagcgagggtggctccccactgacctcccaagctctggag
agcaacgacgccggcctgcccgagtcttccaacccccggcagggccacccctccccacag
cgctacatctccgagccctacctggccctgcacgaagactcccacgcctcggactgcggc
gaggaggagacgctcacctttgaagcagccgtggccaccagcctgggccggtccaacacc
atcggctcggccccgcccctgcggcacagctggcagatgcccaatgggcactatcggcgg
cggaggcgcggggggcctggaccgggcacgacgtgcggagccgtcagcgacctcctgagt
gacacggaagaagacgacaaatgctag

DBGET integrated database retrieval system