KEGG   Bos taurus (cow): 359714Help
Entry
359714            CDS       T01008                                 

Gene name
APTX
Definition
(RefSeq) aprataxin
  KO
K10863  aprataxin [EC:3.1.11.7 3.1.11.8 3.1.12.2]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bta03400]
    359714 (APTX)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.7  adenosine-5'-diphospho-5'-[DNA] diphosphatase
     359714 (APTX)
    3.1.11.8  guanosine-5'-diphospho-5'-[DNA] diphosphatase
     359714 (APTX)
   3.1.12  Exodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.12.2  DNA-3'-diphospho-5'-guanosine diphosphatase
     359714 (APTX)
DNA repair and recombination proteins [BR:bta03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     359714 (APTX)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Other NHEJ factors
     359714 (APTX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FHA_2 DcpS_C HIT zf-C2HE FHA
Motif
Other DBs
NCBI-GeneID: 359714
NCBI-ProteinID: NP_872595
BGD-bta: BT12795
Ensembl: ENSBTAG00000013947
VGNC: 26043
UniProt: Q7YRZ2
LinkDB All DBs
Position
8
AA seq 356 aa AA seqDB search
MSNVSLSASAVSRVMMRVCWLVRQDNRHQRIKLPHLETVMVGRSPETKIADKKCSRQQVQ
LKAECNKGYVKVKQVGVNPTSIDSVIIGKDQEVKLQPGQVLYLVNELYPYIIEFEEETKS
PGLESHRKRKRSGSSDPTERGADPEAEPSTGLEPGSNPHQCSVPPKKEKDASIKKESLGH
WSQGLKISMEDPKMQVYKDEQVVVIKDKYPKARFHWLVLPWASISSLKAVTREHLELLRH
MHAVGEKVIADFAGSSKFRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEY
FLESQAVIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHWSK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgtgagcttgtcggcctcagccgtctcgagagtaatgatgcgggtgtgctgg
ttggtgagacaggacaaccggcaccagcgaatcaaacttccacatttggaaacagtcatg
gttgggcgcagcccagagaccaagatcgccgacaagaagtgttctcgacagcaagtacag
ttgaaagcagagtgtaacaaaggatatgtcaaggtaaagcaggtaggggtcaatcccacc
agcattgactcagtcataattgggaaggaccaggaggtgaagctgcagcctggccaggtc
ctctacctggtgaatgaactttatccgtatattatagagtttgaggaagagacaaagagc
cctggcctggagtcacacaggaagagaaagaggtcaggcagtagcgatcctacagaaagg
ggtgctgacccggaagctgagcccagcacaggactggaacctgggagcaaccctcaccag
tgctctgtgcctccaaagaaggagaaggatgcatccatcaaaaaggaatccttgggccac
tggagtcaaggcttgaagatttctatggaggaccccaaaatgcaggtttacaaagatgag
caggtggtggtgataaaggataaataccccaaggctcgtttccactggctggtcttacct
tgggcctccatttccagtctgaaggctgtgaccagagaacatcttgagctcctcagacac
atgcacgctgttggagagaaagtgattgctgacttcgctgggtccagcaaattccgcttc
cgattgggctaccatgccattcccagcatgagccatgtacacctccatgtgatcagccag
gattttgattctccttgccttaaaaacaaaaaacactggaattctttcaatactgagtac
ttccttgaatcacaagctgtgattgagatggtgcaagaggctggcagggtgaccgtccga
gacgggatgcccgagctcctgaagctgcccctccgttgtcacgagtgccagcagctgctg
ccttccatccctcagctgaaggagcacctcaggaagcactggtccaagtga

DBGET integrated database retrieval system