KEGG   Bos taurus (cow): 407997Help
Entry
407997            CDS       T01008                                 

Gene name
TGM1
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    407997 (TGM1)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     407997 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 407997
NCBI-ProteinID: NP_001010991
Ensembl: ENSBTAG00000003920
VGNC: 35809
UniProt: Q6TNF3
LinkDB All DBs
Position
10
AA seq 846 aa AA seqDB search
MPSPTPSSGGPRSDVGRWGGNPWQPPTTPSPEPEPEPDRRSRRGGRSFWARCCGCCSCRN
TEDDDWGPERHGDRGGRGSGSRNRRPDSRGSDSRQPGSRDSRRPGSRDSRRPGSRDSRRP
GSRGSAVNAAGDGTIREGMLVVTGVDLLSSRSDQNRREHHTDEFEYDELILRRGQPFQMV
LFLSRPYESSDHVTLELCIGNNPEVGKGTHVIIPVGKGGSGGWKAQVTKSSGQNLNLRVH
TSPNAIIGKFQFTIRTRCEAGEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLN
ESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYILDRRGMPYGGRGDPVSVSRVISAMVN
SLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLSYLRTGNSVPFGQCWVFAGVTTTVLRC
LGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPS
GFDGWQVVDATPQETSSGIFCCGPCSVQSIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDD
GSFKIVYVEEKAIGSLIITKAIGSNMREDITHTYKHPEGSEAERKAVETAAAHGSKPNVY
ATRDSAEDVAVQVEAQDAVMGQDLMVSVVLTNRGSSLRTVKLHLYLSVTFYTGVTGSVFK
ESKKEVVLAPGASERVTMPVAYKEYRVHLVDQGAMLLNISGHVKENGQVLAKQHTFRLRT
PDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETV
TLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPASGGGAFSDIRGSGRSGETIPM
ASRGGA
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgccaacaccttcatcaggtggtcctcgttcagatgttggccgctggggcgga
aacccctggcagccccccaccacaccttctccagagccagaaccagagccagacagacgt
tctcgccgcgggggccgttccttctgggctcgctgctgtggctgctgctcttgccggaac
acagaagacgatgactgggggcctgagcgccatggagaccggggaggtcgaggatctggc
tccaggaatcgaagacccgactcccggggctcagactcccgccagcctggctcccgggac
tcccgccggcctggctcccgggactcccgccggcctggctcccgggactcccgccggcct
ggctcccggggcagtgctgtgaacgcagctggagatggcaccatccgggagggaatgctg
gtggtgactggtgtggatctgctgagttcacgctcagaccagaaccgccgagagcaccac
acggacgagttcgagtacgatgagctgattctccgccgtgggcagcctttccaaatggtc
ctcttcctgtctcgtccctatgagtcgtctgatcatgtcaccctggagctgtgcatcgga
aataatcctgaggtgggcaagggcacccatgtgatcatcccggtgggcaaggggggcagt
ggaggctggaaggcccaggtgaccaagtccagtgggcagaatctgaacctacgggtccac
acctcccccaatgccatcatcggcaagttccagttcaccatccgcacacgctgcgaagct
ggagagttccaattgccctttgacccccgcaatgagatctacatcctcttcaatccctgg
tgcccagaggacatcgtgtatgtggaccatgaggactggcggcaggagtacgtgcttaat
gagtctgggcgaatttactatgggacagaagcgcagattggcgagcggacctggaactac
ggccagtttgaccacggggtgctggacgcttgcctgtacatcctggaccggcggggcatg
ccctatggaggccgcggggaccccgtcagtgtctcccgggtcatctctgccatggtgaac
tccctggatgacaatggggtcctgattgggaactggtctggagattattcccgcggcacc
aacccatcagcatgggtgggcagcgtggagatccttctcagctacctacgcaccggcaac
tctgtccccttcggccagtgctgggtcttcgctggtgtgaccaccacagtgctgcgctgc
ctgggcctggccacccgtactgtcaccaacttcaactccgcgcacgacacagacacttcc
ctcaccatggacatctacttcgatgagaacatgaagcccctggagcacctgaaccatgat
tctgtctggaacttccacgtgtggaacgactgttggatgaagaggccagatctgccctca
ggcttcgatggatggcaggttgtggacgccacaccccaggaaaccagcagtggcatcttc
tgctgtgggccctgctctgtgcagtccatcaagaatggcttggtctacatgaagtacgac
acacccttcatttttgcagaggtgaatagtgataaagtttactggcagcgacaggatgac
ggcagcttcaagattgtgtatgtggaggagaaggccatcggctcactcatcattacgaag
gccattggctccaacatgcgggaagacatcacgcacacttataagcacccagaaggctca
gaagcagagcggaaggcagtggagaccgcagccgcccacggcagcaaacccaatgtgtat
gccacgcgggactcagcggaggatgtggccgtgcaggtggaggcgcaggacgcagtgatg
gggcaggacctgatggtctccgtggtgctgaccaaccgcggcagcagcctccgcaccgtg
aagctgcacctctacctctctgtcaccttctacaccggcgtcacaggatccgtcttcaag
gagagcaagaaggaggtggtgctggcgccgggggcctcggagcgtgtgaccatgcctgtg
gcctacaaggaataccgggtccacctcgtagaccagggggccatgctgctcaacatctca
ggccacgtgaaggagaacgggcaggtgctggccaagcagcacaccttccgtctgcgtacc
ccagacctcagtctcacgttactgggagcagccgtggttggccaggagtgcgaagtacag
attgtcttcaagaacccgctgcctgtcaccctcaccaacgtcgtcttccggctcgagggc
tccgggttgcagaggcccaagatcctcaatgttggggacattgggggcaacgagacagtg
accctgcgccagacgttcgtgcctgtgagaccaggcccccgccagctcattgccagcttg
gatagcccacagctctcccaggtgcacggggtcatccaggtggacgtagccccggccagc
ggaggcggggccttctcagacattagaggcagcggtcgctcaggggagaccatccccatg
gcctctcgaggtggggcttag

DBGET integrated database retrieval system