KEGG   Bos taurus (cow): 408015
Entry
408015            CDS       T01008                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04020  Calcium signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04024  cAMP signaling pathway
bta04260  Cardiac muscle contraction
bta04261  Adrenergic signaling in cardiomyocytes
bta04270  Vascular smooth muscle contraction
bta04713  Circadian entrainment
bta04720  Long-term potentiation
bta04723  Retrograde endocannabinoid signaling
bta04724  Glutamatergic synapse
bta04725  Cholinergic synapse
bta04726  Serotonergic synapse
bta04727  GABAergic synapse
bta04728  Dopaminergic synapse
bta04742  Taste transduction
bta04911  Insulin secretion
bta04912  GnRH signaling pathway
bta04921  Oxytocin signaling pathway
bta04924  Renin secretion
bta04925  Aldosterone synthesis and secretion
bta04927  Cortisol synthesis and secretion
bta04929  GnRH secretion
bta04930  Type II diabetes mellitus
bta04934  Cushing syndrome
bta04935  Growth hormone synthesis, secretion and action
bta05010  Alzheimer disease
bta05020  Prion disease
bta05022  Pathways of neurodegeneration - multiple diseases
bta05031  Amphetamine addiction
bta05410  Hypertrophic cardiomyopathy
bta05412  Arrhythmogenic right ventricular cardiomyopathy
bta05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    408015 (CACNA1C)
   04020 Calcium signaling pathway
    408015 (CACNA1C)
   04024 cAMP signaling pathway
    408015 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    408015 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    408015 (CACNA1C)
   04929 GnRH secretion
    408015 (CACNA1C)
   04912 GnRH signaling pathway
    408015 (CACNA1C)
   04921 Oxytocin signaling pathway
    408015 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    408015 (CACNA1C)
   04924 Renin secretion
    408015 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    408015 (CACNA1C)
   04927 Cortisol synthesis and secretion
    408015 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    408015 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    408015 (CACNA1C)
   04270 Vascular smooth muscle contraction
    408015 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    408015 (CACNA1C)
   04727 GABAergic synapse
    408015 (CACNA1C)
   04725 Cholinergic synapse
    408015 (CACNA1C)
   04728 Dopaminergic synapse
    408015 (CACNA1C)
   04726 Serotonergic synapse
    408015 (CACNA1C)
   04720 Long-term potentiation
    408015 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    408015 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    408015 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    408015 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    408015 (CACNA1C)
   05020 Prion disease
    408015 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    408015 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    408015 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    408015 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    408015 (CACNA1C)
   05414 Dilated cardiomyopathy
    408015 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    408015 (CACNA1C)
   04934 Cushing syndrome
    408015 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    408015 (CACNA1C)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   408015 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 408015
NCBI-ProteinID: XP_024848514
LinkDB
Position
5
AA seq 2167 aa
MLRAFFPHSTPGYQPLPRRPAKTQAGSRGTLVHEAQLSCSYVSPGGPSYGSPRPAHANMN
ANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPKK
QGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDD
SNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAI
LEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHI
ALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTV
CKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIII
GSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPEN
EDEGLDEEKPRNMSMPTSETESVNTENVAGGDIEGESCGARLAHRISKSKFSRYWRRWNR
FCRRKCRAAVKSSIFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEM
LLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKIT
RYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDN
FPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAI
AVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVVEKPAVEETKEEKIELKSITA
DGESPPATKINMDDLQPNENEDKSSYPNQETTGEEDEEEPEMPVGPRPRPLSELHLKEKA
VPMPEASAFFIFSPSNRFRLQCHRIVNDSIFTNLILFFILLSSISLAAEDPVQHTSFRNH
ILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAI
NVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLF
KGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTV
STFEGWPELLYRSIDSHTEDKGPIYNYRVEISVFFIIYIIIIAFFMMNIFVGFVIVTFQE
QGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILL
NTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMVLKLIAFKPKHYFCDAWNTFDALIV
VGSIVDIAITEVNPAEHTQCSPFMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLW
TFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFR
CATGEAWQDIMLACMPGKKCAPESEPGNSTEGETPCGSSFAVFYFISFYMLCAFLIINLF
VAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFG
KLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKK
IWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSL
QAGLRTLHDLGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVGYYP
SDGRGAFPQTFTTQRPLHISKAGNSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNAN
NTALGRCPRPALHSGAVSTLEAHGPPLSPAIRVQEAAWRHSSQRCPSRDSPIAMLCQEEA
SGDETCAVHVDENAEHSSEPSLVSTEMLSYQDDENRQLTPPEEDRRDIRLSPKRGFLRSA
SLGRRASFHLECLKRQKNPGGDVSQNTVLPLHLVHHQALAVAGLSPLLQRSHPPGTLPPP
RLTPPATPGPAWPPRPVPTLRLEGAESSDKLTSSFPSIHCDPHIGEPTPCGVVGTPRRAR
PVSLTVPSPAGPQGRPFHGSASSLVEAVLISEGLGQFAQDPRFLEATTQELADACDMTIE
EMESAADDILSGGAGQSPNGTLLPCANCRDPGPDRAGGVEDAAWAPSAEPRQGAEEPRDS
RAFASGL
NT seq 6504 nt   +upstreamnt  +downstreamnt
atgctgcgagccttctttccccactccacgcccgggtaccagccgctgccccgccgcccc
gccaaaacccaggcgggctccaggggtacgctggtgcacgaggctcagctgagctgctcc
tatgtctctcctggaggtcccagctatgggagcccgcgcccggctcacgccaacatgaac
gccaacgcggccgcggggctggcacctgagcacatccccacaccgggggccgccctgtcc
tggcaggccgccatcgacgcggcccggcaggccaagctgatgggcagtgctggcaacgca
accatctccacggtcagctccacgcagcggaaacggcagcagtatgggaagcccaagaag
cagggcagcacgacagccacccgcccgccccgcgccctgctctgcctgaccctaaagaac
cccatccggagggcctgcatcagcatcgtcgagtggaagccatttgaaatcattatttta
ctgactatttttgccaattgtgtggccttagcgatctatattcccttcccagaggacgac
tccaacgccacgaattccaacctggagcgggtggagtatctcttcctcatcatttttact
gtggaagcatttttaaaagtcatagcctacggactcctctttcaccccaacgcttacctc
cgcaatggctggaacttactagactttatcatcgtggttgtcgggcttttcagcgcgatc
ttagagcaagcgaccaaagccgatggggccaacgccctgggagggaagggtgctggattc
gacgtaaaggcgctgagggcgttccgtgtgctacggcccctgcggttggtgtccggggtc
ccgagtctccaggtggtcttgaattccatcatcaaggccatggtgcccctgctgcacatc
gccctgctcgtgctgttcgtcatcatcatctatgccatcatcggcctggagctcttcatg
ggcaagatgcataagacctgctacaaccaggagggcattgcagatgtcccagcagaagac
gacccctcgccctgtgccctggagacaggccacgggcggcagtgccagaatggcacggtg
tgcaaaccaggctgggatggacccaagcacggcatcaccaatttcgacaacttcgccttc
gccatgctgactgtgttccagtgcatcaccatggagggctggaccgacgtcctctactgg
gtcaatgatgccgtgggaagggactggccctggatctattttgtcacattaatcatcata
ggttcattctttgttcttaacttggttctcggtgtccttagcggagagttctccaaagag
cgagagaaggccaaggcccggggagacttccagaagctgcgagagaagcagcagctggag
gaggacctgaagggctacctggactggatcacgcaggccgaggacatcgaccccgagaat
gaggacgagggcctggacgaggagaaaccccgaaacatgagcatgcccaccagtgagacc
gagtctgtcaacaccgaaaacgtggctggaggggacatcgagggagagagctgcggggcc
aggctggcccaccggatctccaagtcaaagttcagccgctactggcgccggtggaatcgg
ttctgcaggaggaagtgccgcgcggccgtgaagtccagcatcttctactggctggtcatc
ttcctggttttcctcaacacactcaccatcgcctccgagcactacaaccagccccactgg
ctcacggaagtccaagacacggccaacaaggcgctgctggccctgttcacggcggagatg
ctgctcaagatgtacagcctgggcctgcaggcctacttcgtgtcgctcttcaaccgcttc
gactgcttcatcgtgtgcgggggcatcctggagaccatcctggtggagaccaagatcatg
tcgccgttgggcatctccgtgctgcgttgcgtgcgcctccttcggatatttaagatcaca
aggtactggaactccctgagcaacctggtggcatccctgctgaactcagtgcgctccatt
gcctcgctgctgctgctgctcttcctcttcatcatcatcttctccctcctggggatgcag
ctctttggggggaagttcaactttgatgagatgcagacccggaggagcacctttgacaac
ttcccgcagtccctcctcaccgtgtttcagatcctgaccggggaggactggaattcggtg
atgtatgatgggatcatggcttatggcggcccctcttttccagggatgttagtctgtatt
tacttcatcatcctcttcatctgtggaaattatatcctactgaacgtgttcttggccatt
gctgtggacaacctggctgacgcggagagcctcacatctgcccagaaggaggaggaagag
gagaaggagaggaagaagctagccaggaccgccagcccagagaagaagcaagaggtggta
gagaagccggccgtggaggagaccaaggaggagaaaatcgagctgaaatccatcacggca
gatggagagtccccacccgccaccaagatcaacatggatgacctccagcccaacgagaat
gaggacaagagctcctaccccaaccaggaaaccacaggagaagaggacgaggaggagccc
gagatgcccgtgggcccccgcccgcgccccctctctgagctgcacctgaaggagaaggca
gtgcccatgccggaagccagcgccttcttcatcttcagccccagcaacaggttccgcctc
cagtgccatcgcatcgtcaatgactccatcttcaccaacctgatcctcttcttcatcctg
ctcagcagcatctccctggccgccgaggaccccgtgcagcacacctccttcaggaaccac
attctgttttattttgacattgttttcactaccattttcaccattgagattgccctgaag
atgacggcctacggggccttcctgcacaagggctccttctgccgcaactacttcaacatc
ctggacctgctggtggtcagtgtgtccctcatctccttcggcatccagtccagtgccatc
aacgtggtgaagatcctgcgagtcctgagggtgctccggccactgagggccatcaacagg
gccaaggggctgaagcacgtcgtgcagtgcgtgttcgtggccatccgcaccatcgggaac
attgtgatcgtcaccacgctgctccagttcatgttcgcctgcattggggtccagctcttc
aagggaaagctctacacctgttcggacagttccaaacagacagaggctgaatgcaagggg
aactacataacatacaaggatggggaggtggaccaccccatcatccagccccgcagctgg
gagaacagcaagtttgactttgacaatgtcctggcagccatgatggccctgttcaccgtc
tccaccttcgagggatggccagagttgctgtaccgctccatcgactctcacacggaggac
aagggtcccatatacaactaccgcgtggagatctccgtcttcttcatcatctacatcatc
atcattgccttcttcatgatgaacatcttcgtgggtttcgtcatcgtcaccttccaggag
cagggggagcaggaatacaagaactgcgagctggacaagaaccagcggcagtgtgtggag
tatgccctcaaggcccggcccctgcggaggtacatcccgaaaaaccagcaccagtacaag
gtgtggtacgtggtcaactccacctacttcgagtacctgatgttcgttctcattctgctc
aacaccatctgcctggccatgcagcactacggtcagagctgtctgttcaaaatcgccatg
aacatcctcaacatgctcttcaccggcctcttcacagtggagatggtcctgaagctcatc
gccttcaagcccaagcactatttctgtgatgcatggaacacatttgacgccttgattgtt
gtgggtagcattgttgatatagccatcaccgaggtaaacccagctgaacatacccaatgc
tctccctttatgaacgcggaagagaactctcgcatctccatcaccttcttccgcctcttc
cgggtcatgcgtctggtcaagctgctgagccgcggggagggcatccggacactgctgtgg
accttcatcaagtccttccaggccctaccctatgtggccctcctgatcgtgatgctgttt
ttcatctacgccgtgatcgggatgcaggtgtttggcaaaattgccctgaatgacacgaca
gagatcaacaggaacaacaacttccagaccttcccccaggccgtgctgctcctcttcagg
tgcgccactggggaggcctggcaggacatcatgctggcctgcatgcctggcaagaagtgc
gcccccgagtcagagccgggcaacagcacagagggggagacgccctgtggcagcagcttc
gccgtcttctacttcatcagcttctacatgctctgcgccttcctgatcatcaacctcttc
gtagccgtcatcatggacaactttgactacctgacgagggactggtccatcctgggtccc
caccacctggacgaatttaagagaatttgggcagagtatgaccctgaagccaagggacgc
atcaaacacctggatgtggtgaccctgctccgacggattcagccccccctgggttttggg
aagctgtgccctcaccgcgtggcttgcaaacgcctggtctccatgaacatgcccctgaac
agcgacgggactgtcatgttcaatgccacgctgtttgccctggtccgtacagctctgagg
atcaagacggaagggaacctggaacaggccaatgaggagctgcgggccatcatcaagaag
atctggaaacggaccagcatgaagctgctggaccaagtggtgccgcccgcaggagatgac
gaggtcacggtgggcaagttttacgctactttcctgatccaggagtatttccggaagttc
aagaagcgcaaagagcaaggcctggtgggcaagccctcccagaggaacgccctgtccctg
caggctggcctgcgcaccctgcacgatctggggcccgagatccgccgggccatctctggg
gacctgaccgccgaggaggagctggacaaggccatgaaggaggctgtgtctgcagcctca
gaagatgacatcttcaggagggccggcggcctgttcggcaaccacgtgggctactacccg
agcgacggccggggcgccttcccccagaccttcaccacccagcgccccctgcacatcagc
aaggcaggcaacagccagggggacaccgagtccccctcccacgagaaactggtggactcc
accttcacccccagcagctactcatccacgggctccaacgccaacatcaacaacgccaac
aacaccgccctgggccgctgcccccgccccgcgctccactccggtgctgtcagcaccttg
gaggcccacgggccccccttgtcccctgccatccgggtgcaggaggccgcgtggaggcac
agctcccagaggtgcccctcccgggacagcccgatagccatgctgtgtcaggaagaggcc
tctggggacgagacctgtgccgtgcacgtggacgagaacgcagagcacagcagcgagccc
agcttggtctccacggagatgctctcctaccaggatgacgagaatcggcagctgactccc
cccgaggaggacaggagggacatccgtctgtccccaaagaggggcttcctgcgctccgcc
tccctaggtcgaagggcctccttccaccttgaatgtctgaagcgacagaagaatcctggg
ggagacgtctctcagaacacagtcctgcctttgcacctggttcaccatcaggcgctggca
gtggcgggtctgagccccctcctgcagagaagccatccccctgggaccctccccccacca
cgcctcacaccccccgccacacctggcccagcctggcctccgcggcctgtgcccaccctg
cggctggaaggggccgagtccagcgacaagctcaccagcagcttcccatccatccactgc
gacccccacatcggggagcccacgccctgcggggttgtcggcaccccccggagggcccgg
cccgtgtcactcactgtgcccagcccggcagggccccagggccgtccgttccatggcagt
gccagcagcctggtggaggcggtcttgatctcggaaggattggggcagtttgctcaggac
cccaggttcctcgaggccaccacgcaggagctggccgatgcctgcgacatgaccattgag
gagatggagagcgcggctgacgacatcctcagcgggggcgccgggcagagccccaacggc
accctgctcccgtgtgcaaactgcagggacccggggccggaccgagcggggggtgtggag
gacgcagcctgggcgcccagcgccgagccccgccagggcgcagaggagccccgggacagc
agggccttcgccagcggcctgtag

DBGET integrated database retrieval system