KEGG   Bos taurus (cow): 504652Help
Entry
504652            CDS       T01008                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase, cytosolic
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bta  Bos taurus (cow)
Pathway
bta00240  Pyrimidine metabolism
bta00983  Drug metabolism - other enzymes
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    504652 (TK1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    504652 (TK1)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     504652 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2
Motif
Other DBs
NCBI-GeneID: 504652
NCBI-ProteinID: NP_001091041
BGD-bta: BT28422
Ensembl: ENSBTAG00000007121
VGNC: 35884
UniProt: A5D7R8
LinkDB All DBs
Position
19
AA seq 238 aa AA seqDB search
MSCINLPNVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQVAQYKCLVIKYAKDTR
YSSLFSTHDRNTMEALPACLLRDVIQDAQRVAVIGIDEGQFFPDIVEFCENMANSGKTVI
VAALDGTFQRKAFGTILNLVPLAESVVKLTAVCMECFREAAYTKRLGVEKEVEVIGGADK
YHSVCRLCYFKKASGQPAVLDSEENKENCPMTLGKPAEAPGVRKLFATHQIWQCSQAN
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcatcaacctgcccaacgtgctgccaggctcccccagcaagacccgggggcag
atccaggtgattctcggacccatgttctcaggaaaaagtactgagctgatgagacgggtc
cgtcgcttccaggttgcccagtacaagtgcctggtgatcaaatatgccaaagacacgcgt
tacagcagcctcttctccacacatgaccggaacaccatggaggccctgccagcctgtctg
ctccgggacgtgatccaggatgcgcagagggtggctgtcataggcatcgacgaagggcag
tttttccctgacattgtggagttctgcgagaacatggccaactcggggaagactgtcatt
gtggctgcgctggatgggacctttcagaggaaggcttttgggaccatcttgaacctggtg
cccctggcagagagcgtggtcaagctgacggcagtgtgcatggagtgcttccgagaggcc
gcctacaccaagaggctgggcgtggagaaggaggtcgaggtcatcggaggagcagacaag
taccactccgtgtgccgcctatgctacttcaagaaggcctcgggtcagcccgccgtgctg
gacagcgaagagaataaggagaactgcccgatgacgctgggaaagcccgcggaggcccca
ggagtccggaagctgtttgccactcatcagatctggcagtgcagccaggccaactga

DBGET integrated database retrieval system