KEGG   Bos taurus (cow): 504668Help
Entry
504668            CDS       T01008                                 

Gene name
MATK
Definition
(RefSeq) megakaryocyte-associated tyrosine-protein kinase
  KO
K08888  megakaryocyte-associated tyrosine kinase [EC:2.7.10.2]
Organism
bta  Bos taurus (cow)
Pathway
bta04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    504668 (MATK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bta01001]
    504668 (MATK)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     504668 (MATK)
Protein kinases [BR:bta01001]
 Non-receptor tyrosine kinases
  CSK family
   504668 (MATK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 RIO1 Kinase-like Haspin_kinase SH3_3
Motif
Other DBs
NCBI-GeneID: 504668
NCBI-ProteinID: NP_001030183
Ensembl: ENSBTAG00000006619
VGNC: 31263
UniProt: Q58D16
LinkDB All DBs
Position
7
AA seq 485 aa AA seqDB search
MRGSPRFLHAWHPSPISARMPTRRWAPGTQCITKCEHTRPKPGELAFCKGDVVTILEACE
NKSWYRAKHHASGQEGLLAAGALREREALSADPKLSLMPWFHGKISGQEAVQQLQPPEDG
LFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEEVCFCNLMDMVEYYSKDQGA
ICTKLVRPKRKQGTKSAEEELAKAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVK
NIKCDVTAQAFLDETAVMTKVQHKNLVRLLGVILHQGLYIVMEHVSKGNLVNFLRTRGRA
LVNTPQLLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAERKGLD
SSRLPVKWTAPEALKHGKFSSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYR
MEPPEGCPGSIHALMGSCWEAEPTRRPPFRKLAEKLARELRSVGASAPNGGQDTDGPAPP
RSQEP
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggaagccctcgcttcctccacgcctggcacccctcacccatctcagccaggatg
ccgacgaggcgctgggcccccggtacccagtgcatcaccaagtgtgagcacacgcgcccc
aaaccaggggagctggccttctgcaagggcgacgtggtcaccatccttgaggcctgtgaa
aacaagagctggtaccgtgccaagcaccacgccagcgggcaggaggggctcctggcggct
ggggcgctgcgggagcgcgaggccctctcggcagaccccaagctcagcctcatgccgtgg
ttccacgggaagatttcgggccaggaggcggtgcagcagctgcagccgcctgaggacggg
ctgttcttggtgcgggagtccgcacggcacccgggtgactacgtgctgtgcgtgagcttc
ggccgcgacgtcatccactaccgcgtgctgcaccgcgacggccacctgaccatcgacgag
gaggtctgcttctgcaacctcatggatatggtggagtattacagcaaggaccagggggcc
atctgcacgaaactcgtgagaccgaagagaaagcaaggcaccaagtcggcggaggaggag
ctggccaaggccggctggttactgaacctgcagcatttgacgttgggagcgcagatcgga
gagggagagtttggagctgtcctgcagggcgagtacctggggcagaaggtggccgtaaag
aatatcaaatgtgacgtaacagcccaggccttcctggacgagacagcggtcatgacgaag
gtgcagcataagaacctggtgcgtctactgggtgtgatcctacatcagggcctctacatc
gtcatggagcacgtgagcaagggtaacttggtgaattttctacggacgcggggccgggcg
cttgtcaacaccccgcagctcctgcagttttccctgcatgtggccgagggcatggaatac
ctggagagcaagaagctggtgcaccgcgatctggctgcccgcaacatcctcgtctcggag
gacctggtggccaaggtcagtgacttcggcctggccaaagccgagcggaaggggctggac
tccagccggctgcccgtcaagtggacagcacccgaggctctcaagcatgggaagttctcc
agcaagtcggatgtctggagcttcggggtgctgctatgggaggtcttctcatacggccgg
gctccataccccaagatgtcgctgaaggaggtgtcagaggccgtggagaaggggtaccgc
atggagccccctgaaggctgccctgggtccatccatgccctcatgggcagctgctgggaa
gctgaacccactcgccggccacccttccgcaaactggctgagaagctggcccgggagcta
cgcagcgtgggtgcttcagcccccaatggggggcaggacacggacggtcccgccccgccc
cgcagccaggagccctga

DBGET integrated database retrieval system