KEGG   Bos taurus (cow): 505622Help
Entry
505622            CDS       T01008                                 

Gene name
GALNT17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
bta  Bos taurus (cow)
Pathway
bta00512  Mucin type O-glycan biosynthesis
bta01100  Metabolic pathways
Module
bta_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    505622 (GALNT17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bta01003]
    505622 (GALNT17)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     505622 (GALNT17)
Glycosyltransferases [BR:bta01003]
 O-Glycan biosynthesis
  Mucin-type
   505622 (GALNT17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 505622
NCBI-ProteinID: NP_001178996
BGD-bta: BT23471
Ensembl: ENSBTAG00000008718
VGNC: 49925
UniProt: E1B9U7
LinkDB All DBs
Position
25
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPISVRSGDSFHEIRPRAEAANISAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDTFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPMENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNAKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNRGTGRCLEVENRGLAGIDLTLRSCTGQRWTIKNSIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctcttggtgttgaacttgatcgcggtggccggc
ttcgtgctcttcttggccaagtgccggcccatctcggtgcgcagcggagactccttccat
gagattcggccgcgggccgaggccgctaacatcagcgcgcacagcgccagccccatccag
gatgcggtcctgaagcgcctctcgctgctcgaggacattgtctaccggcaactaaacggt
ttatccaaatcccttgggctcattgaaggttatggtgggcggggcaaaggaggccttcct
gccaccctttcccctgctgaagaagagaaagccaagggaccccatgagaaatatggctac
aattcctacctcagtgaaaaaatttcactggatcgttccattccggattatcgtcccacc
aagtgtaaggagctgaagtactccaaggagctgccccagatatccatcatatttatcttc
gtgaacgaggccctgtcggtgatcctgcgctcagttcacagcgcggtcaaccacacgccg
acccacctgctgaaggagatcatcctggtggatgacaacagtgacgaagaggagctgaag
gcccccttggaggagtatgtccacaaacgctaccccgggctggtgaaggtggtgagaaac
cagaagagagagggactgatccgagctcgtattgagggctggaaggtggccaccggccag
gtcactggcttctttgatgcccacgtggagttcaccgctggctgggccgaaccagtgctc
tcgcggatccaggagaaccggaagcgtgtgatccttccctccatcgacaacatcaagcag
gacaccttcgaggtgcagcggtatgagaactcggcccacgggtacagctgggagctatgg
tgcatgtacatcagccccccgaaagactggtgggacgccggagacccttccctccccatc
aggacaccagccatgatcggctgctcgtttgtggtcaacaggaagttctttggtgaaatc
ggtcttctggaccctgggatggatgtgtatggaggagaaaatatcgaacttggaatcaag
gtgtggctgtgtgggggcagcatggaggtcctgccttgctcacgggtggcccacatcgag
cggaagaagaaaccgtacaacagcaacatcggcttctacaccaagaggaacgctctacgg
gttgctgaagtctggatggacgactacaagtctcatgtgtacatagcgtggaatctgccg
ctagagaatccaggaattgacattggcgatgtctctgaaagaagagccttaaggaaaagt
ttaaagtgtaagaatttccagtggtatctggaccacgtctacccagaaatgcgaagatac
aataacaccgtcgcctacggggagcttcgcaacaacaaggcaaaagacgtctgcttggac
caggggccaatggagaaccacacagcaatactgtacccgtgccacggctggggaccccag
ctggctcgctacaccaaggagggcttcctgcacttgggcgccctggggaccaccacgctc
ctccctgacacccgctgcctggtggacaacgccaagagtcggctgccccagctcctggac
tgcgacaaggtcaagagcagcctgtacaagcgctggaacttcatccagaacggcgccatc
atgaacagaggcacgggacgctgcctggaggtggagaaccgaggcctggcgggcattgac
ctcacgctccgcagctgcacggggcagaggtggacgatcaagaactccatcaagtag

DBGET integrated database retrieval system