KEGG   Bos taurus (cow): 505642Help
Entry
505642            CDS       T01008                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione-S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bta  Bos taurus (cow)
Pathway
bta00480  Glutathione metabolism
bta00980  Metabolism of xenobiotics by cytochrome P450
bta00982  Drug metabolism - cytochrome P450
bta00983  Drug metabolism - other enzymes
bta01100  Metabolic pathways
bta01524  Platinum drug resistance
bta05200  Pathways in cancer
bta05204  Chemical carcinogenesis
bta05225  Hepatocellular carcinoma
bta05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    505642 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    505642 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    505642 (GSTO1)
   00983 Drug metabolism - other enzymes
    505642 (GSTO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    505642 (GSTO1)
   05204 Chemical carcinogenesis
    505642 (GSTO1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    505642 (GSTO1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    505642 (GSTO1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    505642 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bta02000]
    505642 (GSTO1)
Enzymes [BR:bta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     505642 (GSTO1)
Transporters [BR:bta02000]
 Other transporters
  Pores ion channels [TC:1]
   505642 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 505642
NCBI-ProteinID: NP_001068682
Ensembl: ENSBTAG00000003989
UniProt: Q0VCE1
LinkDB All DBs
Position
26
AA seq 241 aa AA seqDB search
MSGGSARSLGKGSAPPGPVPEGLIRVYSMRFCPYAQRTRLVLTAKGIRHEVININLKNKP
EWFFKKNPSGLVPVLETSQGQLICESAITCEYLDEAYPGKKLLPGDPYEKACQKMVLESF
SKVPPLILKILRTQNKEDCSGLKEELHKEITKLEEVLTDKKTTFFGGNSLSMIDYLIWPW
FERLEALELNECVDHAPTLKLWMAAMKKDPTVSSLLTDVKTFQGFFNLYLQNNPEAYDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaggatcagctaggagcctgggcaagggaagcgcccccccggggcccgtcccc
gagggcctgatccgtgtctacagcatgaggttctgcccgtatgcccagaggactcgcctg
gtcctgacggccaagggtatccggcatgaagtcatcaacatcaacctgaaaaataagcct
gagtggttcttcaagaagaatccctcaggcctggtgccggttctggaaaccagtcagggt
caattgatctgtgaatctgccatcacttgtgagtacctggatgaagcatatccagggaag
aagctgttgccaggcgacccctatgagaaagcttgccaaaagatggtcttggagtccttt
tctaaggtaccacctttgatattgaagattcttagaacacaaaataaggaagactgctct
ggcctaaaagaagaattgcataaagaaatcaccaagctagaggaggttctgactgataag
aagacaaccttctttggtggcaattctctttctatgattgattacctcatctggccctgg
tttgaacgtctggaagctctggagttgaatgagtgtgtagaccacgctccaactcttaag
ctgtggatggcagccatgaagaaggatcccacagtatcatctctcctcactgacgtgaag
acctttcaaggtttcttcaacctctacttgcagaacaaccctgaggcttatgactatgga
ctctga

DBGET integrated database retrieval system