KEGG   Bos taurus (cow): 507188Help
Entry
507188            CDS       T01008                                 

Gene name
GLB1
Definition
(RefSeq) beta-galactosidase precursor
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
bta  Bos taurus (cow)
Pathway
bta00052  Galactose metabolism
bta00511  Other glycan degradation
bta00531  Glycosaminoglycan degradation
bta00600  Sphingolipid metabolism
bta00604  Glycosphingolipid biosynthesis - ganglio series
bta01100  Metabolic pathways
bta04142  Lysosome
Module
bta_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    507188 (GLB1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    507188 (GLB1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    507188 (GLB1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    507188 (GLB1)
   00511 Other glycan degradation
    507188 (GLB1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    507188 (GLB1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     507188 (GLB1)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   507188 (GLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 507188
NCBI-ProteinID: NP_001030215
BGD-bta: BT14677
Ensembl: ENSBTAG00000015254
VGNC: 29391
UniProt: Q58D55
LinkDB All DBs
Position
22
AA seq 653 aa AA seqDB search
MPGVVRLLALLLVPLLLGSARGLHNATQRTFQIDYRRNRFLKDGQPFRYISGSIHYFRVP
RFYWKDRLLKMKMAGLNAIQTYVAWNFHELQPGRYNFSGDHDVEHFIQLAHELGLLVILR
PGPYICAEWDMGGLPAWLLEKKSIVLRSSDPDYLAAVDKWLGVLLPKMRPLLYKNGGPII
TVQVENEYGSYLSCDYDYLRFLQKRFHDHLGEDVLLFTTDGVNERLLQCGALQGLYATVD
FSPGTNLTAAFMLQRKFEPTGPLVNSEFYTGWLDHWGQRHSTVSSKAVAFTLHDMLALGA
NVNMYMFIGGTNFAYWNGANIPYQPQPTSYDYDAPLSEAGDLTEKYFALRDIIQKFAKVP
EGPIPPSTPKFAYGKVALNKLKTVEDALNILCPSGPIKSVYPLTFIDVKQYFGFVLYRTM
LPEDCSDPTPLSSPLSGVHDRAYVSVNGVAQGILERESVITLNITGKAGATLDLLVENMG
RVNYGSSINDFKGLVSNLTLGSKILTNWEIFPLDMEDAVRSHLGTWGGRDRGYHNKARAH
SPPTYALPTFYVGNFTIPSGIADLPQDTFIQFPGWTKGQVWINGFNLGRYWPVRGPQMTL
FVPQHILVTSTPNTIVVLELEHAPCQDGGPELCTVEFVDKPVFRTVQTHRHAN
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgccgggggtcgttcgcctcctcgctctgctgctggtgccgctgctgctgggctctgcg
cgtggtttgcacaacgccacccagagaacattccagatcgactaccgccgtaaccgcttc
ctcaaggatggccagcccttccgctacatctcgggaagcattcactatttccgtgtgccc
cgcttctactggaaggaccggctgctgaagatgaagatggctgggctgaacgccatccag
acgtacgtggcctggaacttccatgagctgcagcctggacggtacaatttctccggggac
catgatgtggaacatttcattcagctggcacatgagctgggactgctggtcatcctgagg
cctggaccctacatctgtgcagagtgggacatgggaggattacctgcttggctattggag
aaaaaatctattgttctccgttcttcggatccagattaccttgcggctgtggacaagtgg
ctgggggtccttctgcccaagatgagacccctcctctataagaatggaggcccgattata
acagtgcaggttgaaaatgaatatggcagctacctctcctgtgattacgactacttgcgt
ttcctgcagaagcgtttccacgaccacctgggtgaggatgtgcttctgttcaccacggac
ggggtgaatgagaggttgctgcagtgtggggcgctccaggggctctacgccaccgtggac
ttcagcccaggtaccaacctcaccgctgctttcatgctccagaggaaatttgaacccaca
ggacccctggtcaattctgaattctacactggatggttagatcactggggccagcgtcat
tccacagtcagctccaaagcagtggctttcacccttcatgatatgcttgctctcggggca
aatgtaaacatgtacatgtttataggtggcaccaattttgcctattggaatggagccaac
ataccctaccaaccacagcccaccagctacgactatgatgcccccctgagcgaggccggg
gacctcactgagaagtattttgctctgcgggatattattcagaagtttgcaaaagtacca
gaaggtcctatccccccatccacaccgaagtttgcatatggaaaagttgctctgaataag
ttaaagacagtggaggatgctctcaacatcctgtgtccctctggacccataaaaagtgtt
tatcccttgacatttatcgatgtgaaacagtactttggatttgtgctgtaccgaacaatg
ctccctgaagactgcagcgaccctacacccctctcttcaccactcagtggtgtccatgac
cgggcctacgtctctgtgaacggggttgcccagggaatccttgaacgagaatctgtgatc
accctgaacataacagggaaagctggagccaccttggacctcctggtggagaatatgggg
cgtgtgaactatggctcgtctatcaatgattttaagggtcttgtttctaacctgaccctt
ggttccaaaatccttaccaactgggagatcttcccgctggacatggaggatgcagtacgc
agtcacctggggacctggggtggccgtgaccggggctaccacaataaagcccgtgcacac
agcccccctacctacgcactcccgaccttttatgtgggtaacttcactattcccagcggg
atcgcagacttgcctcaggacacctttatccagtttcctggatggaccaagggtcaggtg
tggatcaacggctttaacctcggccgctactggccagtgcggggcccccagatgaccctg
ttcgtgcctcagcacatcctggtgacctcgaccccaaacaccatcgtggtgctagagctg
gagcatgcgccctgccaggacggcggcccggaactgtgcaccgtggagttcgtggacaag
ccggtttttcgcacagtccagacccacagacatgcaaactag

DBGET integrated database retrieval system