KEGG   Bos taurus (cow): 507188Help
Entry
507188            CDS       T01008                                 

Gene name
GLB1
Definition
(RefSeq) beta-galactosidase precursor
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
bta  Bos taurus (cow)
Pathway
bta00052  Galactose metabolism
bta00511  Other glycan degradation
bta00531  Glycosaminoglycan degradation
bta00600  Sphingolipid metabolism
bta00604  Glycosphingolipid biosynthesis - ganglio series
bta01100  Metabolic pathways
bta04142  Lysosome
Module
bta_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    507188 (GLB1)
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    507188 (GLB1)
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    507188 (GLB1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    507188 (GLB1)
   00511 Other glycan degradation
    507188 (GLB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    507188 (GLB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    507188 (GLB1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     507188 (GLB1)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   507188 (GLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 507188
NCBI-ProteinID: NP_001030215
BGD-bta: BT14677
Ensembl: ENSBTAG00000015254
VGNC: 29391
UniProt: Q58D55
LinkDB All DBs
Position
22
AA seq 653 aa AA seqDB search
MPGVVRLLALLLVPLLLGSARGLHNATQRTFQIDYRRNRFLKDGQPFRYISGSIHYFRVP
RFYWKDRLLKMKMAGLNAIQTYVAWNFHELQPGRYNFSGDHDVEHFIQLAHELGLLVILR
PGPYICAEWDMGGLPAWLLEKKSIVLRSSDPDYLAAVDKWLGVLLPKMRPLLYKNGGPII
TVQVENEYGSYLSCDYDYLRFLQKRFHDHLGEDVLLFTTDGVNERLLQCGALQGLYATVD
FSPGTNLTAAFMLQRKFEPTGPLVNSEFYTGWLDHWGQRHSTVSSKAVAFTLHDMLALGA
NVNMYMFIGGTNFAYWNGANIPYQPQPTSYDYDAPLSEAGDLTEKYFALRDIIQKFAKVP
EGPIPPSTPKFAYGKVALNKLKTVEDALNILCPSGPIKSVYPLTFIDVKQYFGFVLYRTM
LPEDCSDPTPLSSPLSGVHDRAYVSVNGVAQGILERESVITLNITGKAGATLDLLVENMG
RVNYGSSINDFKGLVSNLTLGSKILTNWEIFPLDMEDAVRSHLGTWGGRDRGYHNKARAH
SPPTYALPTFYVGNFTIPSGIADLPQDTFIQFPGWTKGQVWINGFNLGRYWPVRGPQMTL
FVPQHILVTSTPNTIVVLELEHAPCQDGGPELCTVEFVDKPVFRTVQTHRHAN
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgccgggggtcgttcgcctcctcgctctgctgctggtgccgctgctgctgggctctgcg
cgtggtttgcacaacgccacccagagaacattccagatcgactaccgccgtaaccgcttc
ctcaaggatggccagcccttccgctacatctcgggaagcattcactatttccgtgtgccc
cgcttctactggaaggaccggctgctgaagatgaagatggctgggctgaacgccatccag
acgtacgtggcctggaacttccatgagctgcagcctggacggtacaatttctccggggac
catgatgtggaacatttcattcagctggcacatgagctgggactgctggtcatcctgagg
cctggaccctacatctgtgcagagtgggacatgggaggattacctgcttggctattggag
aaaaaatctattgttctccgttcttcggatccagattaccttgcggctgtggacaagtgg
ctgggggtccttctgcccaagatgagacccctcctctataagaatggaggcccgattata
acagtgcaggttgaaaatgaatatggcagctacctctcctgtgattacgactacttgcgt
ttcctgcagaagcgtttccacgaccacctgggtgaggatgtgcttctgttcaccacggac
ggggtgaatgagaggttgctgcagtgtggggcgctccaggggctctacgccaccgtggac
ttcagcccaggtaccaacctcaccgctgctttcatgctccagaggaaatttgaacccaca
ggacccctggtcaattctgaattctacactggatggttagatcactggggccagcgtcat
tccacagtcagctccaaagcagtggctttcacccttcatgatatgcttgctctcggggca
aatgtaaacatgtacatgtttataggtggcaccaattttgcctattggaatggagccaac
ataccctaccaaccacagcccaccagctacgactatgatgcccccctgagcgaggccggg
gacctcactgagaagtattttgctctgcgggatattattcagaagtttgcaaaagtacca
gaaggtcctatccccccatccacaccgaagtttgcatatggaaaagttgctctgaataag
ttaaagacagtggaggatgctctcaacatcctgtgtccctctggacccataaaaagtgtt
tatcccttgacatttatcgatgtgaaacagtactttggatttgtgctgtaccgaacaatg
ctccctgaagactgcagcgaccctacacccctctcttcaccactcagtggtgtccatgac
cgggcctacgtctctgtgaacggggttgcccagggaatccttgaacgagaatctgtgatc
accctgaacataacagggaaagctggagccaccttggacctcctggtggagaatatgggg
cgtgtgaactatggctcgtctatcaatgattttaagggtcttgtttctaacctgaccctt
ggttccaaaatccttaccaactgggagatcttcccgctggacatggaggatgcagtacgc
agtcacctggggacctggggtggccgtgaccggggctaccacaataaagcccgtgcacac
agcccccctacctacgcactcccgaccttttatgtgggtaacttcactattcccagcggg
atcgcagacttgcctcaggacacctttatccagtttcctggatggaccaagggtcaggtg
tggatcaacggctttaacctcggccgctactggccagtgcggggcccccagatgaccctg
ttcgtgcctcagcacatcctggtgacctcgaccccaaacaccatcgtggtgctagagctg
gagcatgcgccctgccaggacggcggcccggaactgtgcaccgtggagttcgtggacaag
ccggtttttcgcacagtccagacccacagacatgcaaactag

DBGET integrated database retrieval system