KEGG   Bos taurus (cow): 508541
Entry
508541            CDS       T01008                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
bta  Bos taurus (cow)
Pathway
bta01521  EGFR tyrosine kinase inhibitor resistance
bta04062  Chemokine signaling pathway
bta04066  HIF-1 signaling pathway
bta04068  FoxO signaling pathway
bta04217  Necroptosis
bta04550  Signaling pathways regulating pluripotency of stem cells
bta04630  JAK-STAT signaling pathway
bta04659  Th17 cell differentiation
bta04917  Prolactin signaling pathway
bta04920  Adipocytokine signaling pathway
bta04931  Insulin resistance
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta04935  Growth hormone synthesis, secretion and action
bta05145  Toxoplasmosis
bta05160  Hepatitis C
bta05161  Hepatitis B
bta05162  Measles
bta05163  Human cytomegalovirus infection
bta05167  Kaposi sarcoma-associated herpesvirus infection
bta05169  Epstein-Barr virus infection
bta05200  Pathways in cancer
bta05203  Viral carcinogenesis
bta05205  Proteoglycans in cancer
bta05206  MicroRNAs in cancer
bta05212  Pancreatic cancer
bta05221  Acute myeloid leukemia
bta05223  Non-small cell lung cancer
bta05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bta05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    508541 (STAT3)
   04066 HIF-1 signaling pathway
    508541 (STAT3)
   04068 FoxO signaling pathway
    508541 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    508541 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    508541 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    508541 (STAT3)
   04062 Chemokine signaling pathway
    508541 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    508541 (STAT3)
   04917 Prolactin signaling pathway
    508541 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    508541 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    508541 (STAT3)
   05206 MicroRNAs in cancer
    508541 (STAT3)
   05205 Proteoglycans in cancer
    508541 (STAT3)
   05203 Viral carcinogenesis
    508541 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    508541 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    508541 (STAT3)
   05221 Acute myeloid leukemia
    508541 (STAT3)
   05223 Non-small cell lung cancer
    508541 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    508541 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    508541 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    508541 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    508541 (STAT3)
   05161 Hepatitis B
    508541 (STAT3)
   05160 Hepatitis C
    508541 (STAT3)
   05163 Human cytomegalovirus infection
    508541 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    508541 (STAT3)
   05169 Epstein-Barr virus infection
    508541 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    508541 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    508541 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bta03000]
    508541 (STAT3)
Transcription factors [BR:bta03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    508541 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 508541
NCBI-ProteinID: NP_001012689
BGD-bta: BT11963
Ensembl: ENSBTAG00000021523
VGNC: 35371
UniProt: P61635 F1MX38 Q32LP6
LinkDB
Position
19
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEDAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEAAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctccagcagctggacacacggtacttggagcagctccatcag
ctgtacagtgacagcttccccatggagctgcggcagtttctggccccttggattgagagt
caagattgggcatacgcggccagcaaagaatcacatgcgactttggtgtttcataatctc
ttgggagaaattgaccaacagtatagccgcttcctgcaagagtccaatgttctctatcag
cacaatttgcgaagaatcaagcagttccttcagagcagataccttgagaagccaatggag
attgcccgaattgtggcccgttgcctgtgggaagagtcccgcctcctccaaactgcagcc
actgcagcccagcaagggggccaggccaaccaccccacagccgccgtggtaacggagaag
cagcagatgctggagcagcacctgcaggacgtccgcaagcgtgtccaggatctagaacag
aagatgaaagtggtagagaatctccaggatgatttcgatttcaactataaaactctcaag
agtcaaggagacatgcaagatctgaatggaaacaaccagtcggtgaccaggcagaagatg
cagcagctcgaacagatgcttactgccctggaccagatgcggcgcagcatcgtgagtgag
ctggcggggcttttgtcagcgatggagtatgtgcagaaaactctcacggatgaagaattg
gctgactggaagaggcgacaacagattgcttgcattggaggccctcccaacatctgccta
gatcggctagaaaactggataacctcattagcagaatctcagcttcagacccgccaacaa
attaagaaactggaggagctgcagcagaaggttagctacaaaggggaccccattgtacag
caccggccaatgctggaggagagaatcgtggagctgtttagaaacttaatgaaaagtgcc
ttcgtagtggagcggcagccctgcatgcctatgcatcctgaccggccattagtcatcaag
accggtgtccagttcacaactaaagtcagattgctggttaaattccctgagctaaattat
caacttaagattaaagtgtgcattgacaaagactccggggacgttgcagctctcagaggg
tcccggaaatttaacattctgggcacaaacacgaaagtgatgaacatggaagagtctaac
aatggcagcctctcagcggagttcaaacacttgaccctgagagagcagagatgcggtaat
gggggccgagccaattgtgatgcctccctgattgtgaccgaggagctgcacctgatcacc
tttgagactgaggtgtatcaccaaggcctcaagattgacctggagacccactccttgcca
gtggtggtgatctccaacatctgtcagatgcccaatgcctgggcgtccatcctatggtac
aacatgctgaccaacaaccccaagaacgtgaactttttcaccaaacccccgatcggaacg
tgggatcaagtggccgaggtgctgagctggcagttctcctctaccaccaagcgcgggctg
agcatcgagcagttgacgacgctggcggagaaactcttaggacctggtgtgaactattca
gggtgtcagatcacatgggctaaattttgcaaagaaaacatggctggcaagggcttctcc
ttctgggtctggctggacaacatcattgacctggtgaaaaagtacatcctggccctttgg
aacgaagggtatataatgggcttcatcagcaaggagagggaacgggccatcttgagcact
aagcccccaggtaccttcctgctgagattcagtgaaagcagcaaagaaggaggcgtcacc
ttcacctgggtggagaaggacatcagcggcaagacccagatccagtcagtggaaccttac
accaagcagcagctgaacaacatgtcatttgctgaaataatcatgggctataagatcatg
gatgccaccaatatcctggtgtctccactggtctatctctaccccgacattccaaaggag
gacgcgttcggaaagtactgtcggccggagagccaggagcatcctgaagccgacccaggt
agtgctgccccgtacctgaagaccaagttcatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaagctgctgaaccctcagcaggagggcagtttgagtccctcacgttcgacatggag
ctgacctcggagtgcgctacctcccccatgtga

DBGET integrated database retrieval system