KEGG   Bos taurus (cow): 509484Help
Entry
509484            CDS       T01008                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme (peptidyl-dipeptidase A) 3 precursor
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
bta  Bos taurus (cow)
Pathway
bta04614  Renin-angiotensin system
bta04924  Renin secretion
bta05142  Chagas disease (American trypanosomiasis)
bta05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    509484 (ACE)
   04614 Renin-angiotensin system
    509484 (ACE)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    509484 (ACE)
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    509484 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bta01002]
    509484 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    509484 (ACE)
   04090 CD Molecules [BR:bta04090]
    509484 (ACE)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     509484 (ACE)
Peptidases [BR:bta01002]
 Metallo Peptidases
  Family M2
   509484 (ACE)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   509484 (ACE)
CD molecules [BR:bta04090]
 Proteins
  509484 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 509484
NCBI-ProteinID: NP_001193597
BGD-bta: BT14279
Ensembl: ENSBTAG00000024950
LinkDB All DBs
Position
19
AA seq 1306 aa AA seqDB search
MGAASGRRSPPLLLPLLLLLLPPPPVILELDPALQPGNFPADEAGAQIFAASFNSSAEQV
LFQSTAASWAHDTNITEENARLQEEAALLSQEFSEAWGQKAKDLFDPVWQNFTDPTLLRI
IGAVRTLGPANLDLEKRQKYNSLLSNMSRIYSTAKVCFPNKTAPCWSLDPELTNILASSR
SYTLLLYAWEGWHNAAGIPLKPLYQDFTALSNEAYKQDGFSDTGAYWRSWYDSPTFTEDL
ERLYQQLEPLYLNLHAYVRRALHRRYGDRYINLRGPIPAHLLGNMWAQSWENIYDTVVPF
PDKPNLDVTDVMVQKGWNATHMFRVAEEFFTSLGLLPMPPEFWAESMLEKPSDGREVVCH
ASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKGQHVSLRRGANPGFHEAI
GDVLALSVSTPAHLHKIGLLDQVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFS
GRTPPSRYNYDWWYLRTKYQGICPPVVRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQF
HEALCKEAGHQGPLHQCDIYQSTQAGAKLRALLQAGSSRPWQEVLKDMVGSDNLDARPLL
SYFQPVTQWLEEQNQQNGEVLGWPEYQWRPPMPDNYPEGIDLVSDEDEARKFVEEYDRRS
QVVWNEYAEANWNYSTDISTDNSKLLMEKNLQMANHTVKYGTWARKFDVTNFQNATMKRM
IKKIQDLERAALPTKELEEYNQILLDMETVYSVASVCHENGTCLRLEPDLTNLMATSRNY
QDLAWAWKSWRDKVGRSILPYFPKYVELTNKAARLNGYQDGGDSWRSMYEMPFLEEELEQ
LFQELQPLYLNLHAYVRRALHRHYGPDVINLEGPIPAHLLGNMWAQSWSNIYDLVAPFPS
APKMDATEAMIKQGWTPLRMFKEADNFFTSLGLLPMPPEFWNKSMLEKPTDGREVVCHAS
AWDFFNGKDFRIKQCTSVNMEDLVVAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGD
VLALSVSTPTHLHKINLLSSGDGGYEEDINFLMKMALEKIAFIPFSFLVDQWRWRVFDGS
VTRENYNQEWWSLRLKYQGVCPPLARSQDDFDPGAKFHIPASVPYVRYFVSFVIQFQFHQ
ALCQAAGHQGPLHKCDIYQSKEAGKLLADAMKLGFSQPWPEAMRLITGQSNMSAAAMMTY
FKPLLDWLVTENGRHGEKLGWPQYNWTPNSARLEGPFVGSGRVNFLGLNLEEQQARVGQW
VLLFLGVALLVATLGLTQRLFSIRHHSLRRPHRGPQFGSEVELRHS
NT seq 3921 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcgtcgggtcgccggtcgccgccgctgctgctgccgttgctgctgctgctc
ctgccgccgccgcccgtgatcctggagctggaccccgcgttgcagccggggaactttccc
gccgacgaggccggggcgcagatcttcgcagccagcttcaactcgagcgccgagcaggtg
ctgttccagagcacggccgccagctgggcgcacgacaccaacatcaccgaggagaacgcg
cggctccaggaggaagcagccttgctcagccaggagttttcagaggcctggggccagaag
gccaaggatctgttcgacccggtctggcagaactttaccgaccccacgctgctgcgcatc
atcggggcggtgcgcaccctgggccccgccaacctggacctagagaagcggcagaagtac
aactctctgctaagcaacatgagcaggatttactccactgccaaggtctgcttccccaac
aagactgccccctgctggtccctggacccagagctcaccaatatcctggcttcctcgcga
agctacaccctgctgctgtatgcctgggagggctggcacaacgccgcgggcatcccactg
aagcccctataccaggacttcactgccctcagcaacgaggcctacaagcaggatggcttc
tcagacacaggggcctactggcgctcctggtatgactctcccaccttcacggaggatctg
gaacgcctctaccagcagctggagcccctctacctgaacctccatgcctacgtccggcgc
gcactgcaccgccgatatggggacagatacatcaacctcaggggacccatccccgctcac
ctgctggggaacatgtgggcccagagctgggagaacatctacgacacggtggtgcccttc
cccgacaagcccaatcttgatgttaccgatgttatggtgcagaagggctggaacgccaca
cacatgttccgggtggcggaggagttcttcacctccctggggctcttgcccatgccaccc
gagttctgggcggaatccatgctggagaagccaagcgacgggcgggaggtggtgtgccac
gcgtccgcctgggacttctacaacaggaaagacttcaggatcaagcagtgcacgcgggtc
actatggaccagctgtccacggtgcaccacgagatgggccacgtgcagtactaccttcag
tacaagggccagcacgtctccctgcgccgaggcgccaaccccggcttccacgaggccatc
ggcgatgtgctggccctctccgtctccactcctgcacacctgcacaagatcggcctgctg
gaccaggtcaccaatgacacagagagtgacatcaactacttgttaaagatggcactggaa
aaaattgccttcctgccctttggctacttggtggaccagtggcgttggggggtctttagt
gggcgaacccccccttcccgctacaactatgactggtggtatcttcgaaccaagtatcag
gggatctgtcctccggttgtccgaaatgaaacccactttgacgctggagccaagtttcac
gtcccaaatgtgaccccgtatatcaggtacttcgtgagctttgtcctgcagttccagttc
cacgaagcgctgtgcaaggaggcaggccaccaaggccccctgcaccagtgtgacatctac
cagtccacccaggcgggggccaagctccgggcgctgctgcaggcaggctcctcacggccc
tggcaggaggtgctgaaggacatggttggctcagacaacctggacgctaggccgctgctc
agctacttccagccggtcacacagtggctcgaggagcagaaccagcagaacggcgaggtc
ctgggctggccagagtatcagtggcgcccaccgatgcccgacaattacccggagggcatt
gacctggtgtccgacgaggacgaggcccgcaagtttgtggaggaatacgaccggagatcc
caggtcgtgtggaacgagtatgccgaggccaactggaactacagcaccgacatcagcacg
gacaacagcaagttgctgatggagaagaacttacagatggcaaaccacaccgtcaagtat
ggcacctgggccaggaagtttgacgtgaccaacttccagaatgccaccatgaagcggatg
ataaagaagattcaggatctagagcgggcagcactgcccaccaaggagctggaagagtat
aaccagatcctgctggacatggagaccgtttacagcgtggcctctgtgtgccacgaaaat
ggcacctgcctgcggctcgagcctgatctgaccaatctgatggccacatcccggaattat
caggacctggcctgggcgtggaagagctggcgcgataaagtggggcggtccatcctcccc
tacttccccaaatacgtggagctcaccaacaaggccgccaggctcaatggctaccaggat
ggcggggactcctggaggtccatgtacgagatgcccttcctagaggaggagctggagcag
ctgttccaagagctgcagccgctctacctgaacctgcacgcctacgtgcgccgggccctg
caccgccactacgggcccgacgtcatcaacctggagggccccatcccagcccacctgctc
gggaacatgtgggcacagagctggtccaacatctatgacttggtggcacccttcccttca
gcccccaagatggatgccacggaggccatgataaagcagggctggacacccctaaggatg
tttaaggaagcagacaatttcttcacctccctggggctgctgcccatgccccctgaattc
tggaacaagtcgatgctggagaagccgactgatgggcgggaagtggtgtgccacgcctcc
gcctgggacttcttcaacggcaaggactttaggatcaagcagtgcacctcggtgaacatg
gaggacctggtggtggcccaccacgaaatgggccacatacagtacttcatgcagtacaag
gacttgcccgtgaccttccgggagggcgccaaccccggctttcacgaggccattggggac
gtgctggccctctcagtgtccacccccacgcacctgcacaagatcaacctgctgagcagt
ggggacggcggctacgaggaggatatcaactttctgatgaagatggcgctcgagaagatt
gccttcatccccttcagcttcctcgtcgaccagtggcgctggagggtgtttgatggaagt
gtcaccagggagaactacaaccaggagtggtggagcctcaggctgaagtaccagggtgtc
tgtcccccactggccagatctcaagatgactttgacccaggggccaagttccacattcct
gcaagtgtgccttacgtcaggtacttcgtcagctttgtcatccagttccagttccaccag
gcgctgtgtcaggcagcgggccaccagggccccctgcacaagtgtgacatctaccagtcc
aaggaggccgggaagctcctggcggatgccatgaagctgggcttcagtcagccgtggccc
gaagccatgcggctgatcacgggccagtccaacatgtcggctgccgccatgatgacctac
ttcaagccgctgctggactggctcgtgacggagaacgggcggcacggggagaagctgggc
tggcctcagtacaactggacgccaaactcggctcgcctggagggccccttcgtgggctcc
ggccgcgtcaacttcctgggcctgaacctggaggagcagcaggcccgcgtgggccagtgg
gtgctgctcttcctgggcgtcgccctgctggtggccacgctgggcctcacccagcggctc
ttcagcatccgccaccacagcctccgccggccccaccgcgggccccagtttggctccgag
gtggagctgagacactcctga

DBGET integrated database retrieval system