KEGG   Bos taurus (cow): 509779
Entry
509779            CDS       T01008                                 

Gene name
CACNA1F
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1F
  KO
K04853  voltage-dependent calcium channel L type alpha-1F
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04020  Calcium signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04024  cAMP signaling pathway
bta04260  Cardiac muscle contraction
bta04261  Adrenergic signaling in cardiomyocytes
bta04270  Vascular smooth muscle contraction
bta04723  Retrograde endocannabinoid signaling
bta04725  Cholinergic synapse
bta04726  Serotonergic synapse
bta04727  GABAergic synapse
bta04911  Insulin secretion
bta04912  GnRH signaling pathway
bta04921  Oxytocin signaling pathway
bta04924  Renin secretion
bta04925  Aldosterone synthesis and secretion
bta04927  Cortisol synthesis and secretion
bta04929  GnRH secretion
bta04934  Cushing syndrome
bta04935  Growth hormone synthesis, secretion and action
bta05010  Alzheimer disease
bta05020  Prion disease
bta05022  Pathways of neurodegeneration - multiple diseases
bta05410  Hypertrophic cardiomyopathy
bta05412  Arrhythmogenic right ventricular cardiomyopathy
bta05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    509779 (CACNA1F)
   04020 Calcium signaling pathway
    509779 (CACNA1F)
   04024 cAMP signaling pathway
    509779 (CACNA1F)
   04022 cGMP-PKG signaling pathway
    509779 (CACNA1F)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    509779 (CACNA1F)
   04929 GnRH secretion
    509779 (CACNA1F)
   04912 GnRH signaling pathway
    509779 (CACNA1F)
   04921 Oxytocin signaling pathway
    509779 (CACNA1F)
   04935 Growth hormone synthesis, secretion and action
    509779 (CACNA1F)
   04924 Renin secretion
    509779 (CACNA1F)
   04925 Aldosterone synthesis and secretion
    509779 (CACNA1F)
   04927 Cortisol synthesis and secretion
    509779 (CACNA1F)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    509779 (CACNA1F)
   04261 Adrenergic signaling in cardiomyocytes
    509779 (CACNA1F)
   04270 Vascular smooth muscle contraction
    509779 (CACNA1F)
  09156 Nervous system
   04727 GABAergic synapse
    509779 (CACNA1F)
   04725 Cholinergic synapse
    509779 (CACNA1F)
   04726 Serotonergic synapse
    509779 (CACNA1F)
   04723 Retrograde endocannabinoid signaling
    509779 (CACNA1F)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    509779 (CACNA1F)
   05020 Prion disease
    509779 (CACNA1F)
   05022 Pathways of neurodegeneration - multiple diseases
    509779 (CACNA1F)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    509779 (CACNA1F)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    509779 (CACNA1F)
   05414 Dilated cardiomyopathy
    509779 (CACNA1F)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    509779 (CACNA1F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    509779 (CACNA1F)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   509779 (CACNA1F)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel Myc_N
Other DBs
NCBI-GeneID: 509779
NCBI-ProteinID: NP_001192592
BGD-bta: BT24811
Ensembl: ENSBTAG00000016097
VGNC: 26676
UniProt: E1B9S9
LinkDB
Position
X
AA seq 1972 aa
MSASEGGKDTTPEPSPANGTGPGPEWGLCPGPPASDGEISGASGLGTPKRKTQHSKHKTV
AVASAQRSPRALFCLTLANPLRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPEDDS
NTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLL
EQGPGRPGDTPHMGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHI
ALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDVEAEEDPSPCASSGSGRACTLNQTECR
GRWAGPNGGITNFDNFFFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGS
FFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLRGYLDWITQAEELDMEDPS
AAGNFGSVAEEGLAGHRPQLEELTNRRRGRLRWFSHSTHSTSSHASLPASDTGSMAETQG
DEEEEEGTVASCTRCLNKIVKTSVCRRLRRANRGLRASCRRAVKSNACYWAVLLLVFLNT
LTIASEHHGQPFWLTQIQEYANKVLLCLFTVEMLLKLYGLGPSVYVSSFFNRFDCFVVCG
GILETTLVEVGAMQPLGISVLRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLL
FLFIIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILTGEDWNVVMYDGIMA
YGGPFFPGMLVCVYFIILFICGNYILLNVFLAIAVDNLASGDAGTDKDKGREKITEETPQ
ENGALVPGGENEEEESAKNEGAGKWAGMEEEEEEEEEEEEVGAGHVELLQEVVPKEKVVP
IPEGSAFFCLSQTNPLRKACHTLIHHHIFTNLILVFIILSSVSLAAEDPIRAHSFRNHIL
GYFDYAFTSIFTVEILLKMTVFGAFLHRGSFCRSWFNLLDLLVVSVSLISFGIHSSAISV
VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKG
KFYSCTDEAKHTPQECKGSFLVYPDGDVSRPLVRERLWVNSDFNFDNVLSAMMALFTVST
FEGWPALLYKAIDANAEDKGPIYNYHVEISVFFIVYIIIIAFFMMNIFVGFVIITFRAQG
EQEYQDCELDKNQRQCVEYALKAQPLRRYIPKNPHQYRVWATVNSAAFEYLMFLLILLNT
VALAMQHYEQTAPFNYAMDILNMVFTGLFTVEMVLKIIAFKPKHYFTDAWNTFDALIVVG
SVVDIAVTEVNNGGHLGESSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSF
QALPYVALLIAMIFFIYAVIGMQMFGKVALQDGTQINRNNNFQTFPQAVLLLFRCATGEA
WQEIMLASLPGSRCDPESDFGPGEEFSCGSNFAIAYFISFFMLCAFLIINLFVAVIMDNF
DYLTRDWSILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGFGKLCPHRVA
CKRLVAMNMPLNSDGTVTFNATLFALVRTSLKIKTEGNLEQANQELRIVIKKIWKRMKQK
LLDEVIPPADEEEVTVGKFYATFLIQDYFRKFRRRKEKGLLGTEAPPSTSSALQAGLRSL
QDLGPEMRQALTCDTEEEEGEEGHEGEEEHEDLETYTALMGSQPPSRRSSVISVSLPAGD
RPPDSLSPGPSDDDGGAPNSRQSNVPQSGSHAHRRSSGVLIFTIPEEGSSQSKATKGQER
QDEQEEVLSQLSYLDEQAGAPPRPILLPSHRPQRYVDGHQAPRRRLLPPTPAGRKPSFNI
QCLRRQGSCEDLPIPGTYHRGRNSGPSRAQGSWATPPQRGRLLYAPLLLVEEGAAGEGYI
GKSSSPLHTFTCLHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEI
ADACRLTLDEMDSAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL
NT seq 5919 nt   +upstreamnt  +downstreamnt
atgtcggcatctgaaggcgggaaagacaccaccccagagcccagtccagccaatgggaca
ggccctgggcccgaatgggggctgtgccctgggcccccagcatcagatggtgaaatcagc
ggggcatcgggcctagggacccctaagcgaaagactcagcacagtaagcacaagacagtg
gcagtagccagtgcccagcggtcaccccgggcactcttctgcctcaccctggcaaacccc
ctgcggcggtcctgcatcagcattgtggaatggaagcccttcgacatcctcatcttgctg
accatctttgccaattgcgtggccctgggagtctacatccccttcccggaggacgactcc
aacactgccaaccacaacctggagcaagtggaatacgtatttttggtgattttcactgtg
gagacggtgctcaagatcgtggcctatggactggtgctccaccccagcgcctacatccgc
aacggctggaacctgctcgacttcatcattgtcgtggtcgggctgttcagcgtgctgctg
gagcagggtcccggacgcccaggggacaccccgcatatgggagggaagccagggggcttc
gatgtgaaggcattgcgggcatttcgggtgctgcggccactgaggctggtgtctggggtc
ccaagcctgcacatagtgctcaattccatcatgaaggctctggtgccgctgttgcatatt
gcacttcttgtgctctttgtcatcatcatttacgccatcattggactggagctgttcctc
ggacgcatgcacaaaacgtgctacttcctgggatctgacgtagaggcggaggaggacccg
tcaccctgtgcgtcctcaggatcagggcgtgcttgcacactgaaccagacggagtgccgc
gggcgctgggcagggcccaacggaggcatcaccaactttgacaactttttcttcgccatg
ctgacagtcttccagtgcatcaccatggaaggctggaccgacgtgctctactggatgcag
gatgccatggggtatgagctgccctgggtgtattttgtgagtctcgtcatctttggatcc
ttcttcgtcctcaaccttgtgcttggtgtcctgagtggggagttctccaaagagagggag
aaggcaaaagcacgaggggatttccagaagcttcgggagaagcagcagctggaggaggac
ctccggggctacctggactggatcacacaggcggaggagctggacatggaggacccctca
gctgctggcaactttggttccgtggctgaagagggcctggccggccaccggccacaactg
gaagagctgaccaataggagacgaggacgtctacgctggttcagtcactccacccactcc
accagcagccatgccagcctcccagccagtgacaccggttcaatggcagagacccaagga
gacgaggaagaggaagagggcactgtagccagctgtacacgctgcctaaataagatcgtg
aaaaccagcgtttgccgccgtctccgccgagccaaccggggccttcgggcgagctgccgg
agggctgtgaagtccaatgcctgctactgggccgtgttgctgctcgtcttcctcaacact
ctgacaatcgcctcggagcaccacgggcagcccttctggctcacccagatccaggagtat
gccaacaaagtgctactctgtctattcacggtggagatgcttctcaagttgtatggtctg
gggccctctgtctacgtgtcctccttcttcaaccgctttgactgcttcgtggtctgtggg
ggcatcctggagactaccctggtggaggtgggtgccatgcagcccctgggcatctcggta
ctccgctgtgtgcgcctcctcaggatctttaaggtcaccaggcactgggcatctctgagc
aatttagtggcgtctctactcaattcaatgaaatccattgcatccttgctgcttctcctc
ttcctctttatcatcatcttctccctgcttggcatgcagctgtttgggggcaagttcaac
tttgaccagacccacaccaagcgaagcacctttgacacctttccccaggccctcctcact
gtctttcagatactgacgggtgaggactggaatgtggtcatgtatgatggtatcatggcc
tatggcggccccttcttcccagggatgctcgtgtgcgtgtatttcatcatcctcttcatc
tgcggcaattacatcctattgaatgtgtttcttgccatcgctgtggacaacctggccagt
ggagatgcaggcactgacaaagataagggcagggagaagatcactgaggaaactccacag
gagaatggagcactggtgcctggtggggagaatgaggaagaggaatctgcaaaaaatgaa
ggagcaggcaagtgggcaggcatggaggaagaggaggaggaggaggaggaggaagaggaa
gtgggggccgggcatgtggaactcctgcaggaagttgtacccaaggagaaggtggtaccc
atccctgagggcagtgctttcttctgcctcagccaaaccaacccgctgaggaaggcctgc
cacaccctcatccaccatcacatcttcaccaatctcatcctggtgtttatcatcctcagc
agtgtgtccctggccgctgaggatcccatccgagcccactccttccgcaaccacattctg
gggtactttgattatgccttcacctccattttcactgtggagattctactaaagatgaca
gtgttcggggctttcctgcaccgtggttccttctgccgtagctggttcaatctgctggat
ctgctggtggtcagcgtgtccctcatctcctttggtatccactccagcgccatctcagtg
gtgaagattctgcgtgtgctccgagtactgcggccccttcgagctatcaacagggccaaa
ggactcaagcatgtggtgcaatgtgtgttcgtggccatccggaccatcggaaatatcatg
atcgtgaccacgctcctgcagttcatgttcgcctgcattggtgtgcagctcttcaagggg
aaattctacagttgcactgatgaggccaaacacacaccccaagaatgcaagggctccttc
ctggtctaccccgatggagatgtgtcaaggcctctggtccgggagcggctctgggtcaac
agcgatttcaactttgacaatgtcctttcagccatgatggccctgttcactgtctccacc
ttcgaaggctggcctgcgctgctatacaaggccattgatgcaaacgcagaggacaagggc
cccatctacaattaccacgtggagatctcagtgttcttcattgtctatatcatcatcatt
gcattcttcatgatgaacatctttgtgggctttgtcatcatcaccttccgagcccagggc
gagcaggagtaccaagactgtgagctggataagaaccagcgccagtgtgtagaatacgcc
ctcaaggcccaaccactccgtcgctatatccccaagaacccacatcagtatcgtgtgtgg
gccactgtgaactctgctgccttcgagtatctcatgttcctgctcatcctgctcaacacg
gttgctctagccatgcagcactatgagcagactgctcccttcaactatgccatggacatc
ctcaacatggtcttcactggcctcttcactgtcgagatggtgctcaaaatcattgccttc
aaacccaagcattactttactgatgcctggaacacatttgatgctcttattgtggtgggc
agcgtagtggacattgccgtcactgaagtcaacaatggtggccacctgggcgagagctct
gaggacagttcccgcatttcgatcaccttctttcgcctcttccgagtcatgcgattggtc
aagcttcttagtaagggtgaagggattcgcacattactttggacattcatcaagtctttt
caggccttaccctatgtggctcttctcatcgcaatgatattcttcatttacgcagtcatt
gggatgcagatgtttggcaaggtggctcttcaggatggcacacagatcaaccgaaacaac
aacttccagacctttccacaggctgtactgcttttgttcaggtgtgctactggtgaggca
tggcaggagataatgcttgccagccttcctggaagccggtgtgaccctgagtctgacttc
ggccctggtgaggagtttagctgtggtagcaattttgccatcgcctattttatcagcttc
ttcatgctctgtgcattcctgatcataaatctctttgtggctgtgatcatggacaacttt
gattatctaaccagagattggtccatcctgggcccccatcacctcgatgaattcaagagg
atttggtctgaatatgaccctggggccaaaggccgcatcaagcacctggatgtggttgcc
ctgctgagacgcatccagcccccactgggatttgggaagctgtgcccacaccgagtggcc
tgcaagagacttgtggcgatgaacatgcccctcaactcagatgggacagtgacattcaac
gccacactatttgccctggtccggacatcactgaagatcaagacggaaggaaacctggag
caagccaatcaggagctgcggattgtcatcaaaaagatctggaaacggatgaagcagaag
ctgctagatgaggtcatcccaccagctgatgaggaagaagttactgtgggcaaattctac
gccacatttctgatccaggactacttccgcaaattccggcggaggaaagaaaaggggcta
ctaggcaccgaggcccccccaagcacctcctctgcccttcaggctggcctgaggagcctg
caagacttgggtccggagatgcggcaggccctcacttgtgacacagaggaagaggaaggg
gaagaggggcatgagggagaggaggaacatgaggacctggaaacatacacagccctgatg
ggctcccagcccccatctcgccggagctccgtgatttctgtgtctctgcctgctggagac
agacctccagattcactttcccctggacccagtgatgacgatgggggggctcccaactcc
agacagtccaatgttccccagtctgggtcccatgcccacaggagaagctctggggttctc
attttcaccattccagaagaaggaagttctcagtccaaggcaaccaaagggcaagagagg
caggatgagcaagaggaagtcctgagccagctctcctacctagatgaacaggcaggggct
cccccacgccccatccttttgccatctcacagaccccagagatacgtggatggccaccaa
gcaccacgccgccgtctgctgcccccaacgcctgcaggtcggaagccatccttcaacatc
cagtgtctgcggcgccagggcagctgtgaagatttacccattccaggcacctatcatcgt
ggacgaaactcagggcccagtagggcacagggttcctgggcaacccctcctcagcggggc
cgactcctatatgccccactgctattggtggaggagggtgcagcaggggagggatacatc
ggcaaatccagcagtccgctgcacaccttcacctgtctgcatgtgcctggaacccactcg
gaccccagccatggcaaaaggggcagtgctgacagcctggtggaggctgtgctcatctct
gagggcctgggcctctttgctcgagacccacgcttcgtggccctggccaagcaggagatt
gcagatgcatgtcgcctgaccctggacgagatggacagtgctgccagtgacctgctggca
caggggaccagctcactgtatagtgacgaagagtccatcctctcccgttttgatgaggag
gacctaggagacgagatggcctgcgtccatgccctctga

DBGET integrated database retrieval system