KEGG   Bos taurus (cow): 510276
Entry
510276            CDS       T01008                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
bta  Bos taurus (cow)
Pathway
bta04014  Ras signaling pathway
bta04390  Hippo signaling pathway
bta04392  Hippo signaling pathway - multiple species
bta05200  Pathways in cancer
bta05206  MicroRNAs in cancer
bta05219  Bladder cancer
bta05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    510276 (RASSF1)
   04390 Hippo signaling pathway
    510276 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    510276 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    510276 (RASSF1)
   05206 MicroRNAs in cancer
    510276 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    510276 (RASSF1)
   05223 Non-small cell lung cancer
    510276 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH Mst1_SARAH
Other DBs
NCBI-GeneID: 510276
NCBI-ProteinID: NP_001068910
BGD-bta: BT13145
Ensembl: ENSBTAG00000020963
VGNC: 33757
UniProt: Q1LZF4
LinkDB
Position
22
AA seq 272 aa
MGEADAGTPSFEMTWNSTTSSGYCSQEDSDSELEQYFTARTSLARRPRRDQDEPVEWETP
DLSQAEIEQKIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDA
RRGPGRGTAVKRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERA
ERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPELHNFLRIL
QREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 819 nt   +upstreamnt  +downstreamnt
atgggtgaggcggacgcgggaacgccttccttcgagatgacttggaacagcacgacaagc
agtggctactgcagccaggaggactcggactcagagctcgagcagtacttcactgcgcgt
acctcgctggcgcgcaggccgcgtcgggaccaggacgagcccgtggagtgggagacacct
gacctttctcaagctgagatcgagcagaagatcaaggagtacaatggccagatcaacagc
aacttgttcatgagcctgaacaaggatggctcctacacaggcttcatcaaggttcaactg
aagctggtgcgccctgtctcagttccctccagcaagaagccaccctccctgcaggatgcc
cggcgaggcccagggcggggcacagctgtgaaacgccgcacctccttctacctgcccaag
gatgctgtcaagcacctgcatgtgttgtcacgcacgcgggcacgtgaggtcatcgaggcc
ctgttgcgtaaattcctggtggtggatgaccctcgcaagtttgcactctttgagcgggct
gagcgccatggccaagtgtacctccggaagctgtccgatgatgagcagcccctacgcctc
cggctccttgcagggcccagtgagaaggccctaagctttgtgctgaaggagaatgactct
ggggaggtgaattgggacgctttcagcatgcctgagctacacaactttctgcgcatcctg
cagcgggaggaagaggaacacctccgccagatcctgcagaagtactcctattgtcgccag
aagatccaggaagccctgcacgcctgccccctggggtga

DBGET integrated database retrieval system