KEGG   Bos taurus (cow): 510442Help
Entry
510442            CDS       T01008                                 

Gene name
DOT1L
Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific isoform X7
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
bta00310  Lysine degradation
bta05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    510442 (DOT1L)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    510442 (DOT1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    510442 (DOT1L)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     510442 (DOT1L)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     510442 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 HALZ
Motif
Other DBs
NCBI-GeneID: 510442
NCBI-ProteinID: XP_003586321
Ensembl: ENSBTAG00000009996
VGNC: 50607
LinkDB All DBs
Position
7
AA seq 1523 aa AA seqDB search
MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQVAAATNCK
HHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVVFV
NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRENKSNTTTPTKVP
ESKAAVPADTPVDSGAEEEKAGTATVKKPSPSKARKKKLNKKGRKMVGRKRGRPKKMSAT
NPERKPKKTQSSLDLLHAQTASRAASPLPQDAHRPPHSPFYQLPPSVQRPTPEQLLLAPT
PPALHRLLESFRIQYLQFLAYTKTPQYKASLQQLLDQEKEKNARLLGAAQQLFGHCQAQK
EEIKRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQTEQLEKGNWELRSQSLRLL
KARCEELKLDWSTLSLENLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLK
SCVPPDEALALQLRGKPEAEPSRLHLELDCARFSLPPFSSLSPELSMNGHAAGYELCSAL
GRPSPKQNTPQYLASPLDQEVVPCTPSHSGRPRLEKLSSLALPDYTRLSPAKLVLRRHLS
QDHAASGKAAASELHPRAEHAKENGLPYQSPGITNGIKLSPQDPRPSSPTALQMGEKGPE
KGVKERAYASSGEAITSLPVSIPLSTVQPSKLPVSIPLASVVLPSRAEKARSTPSPGPPA
RESSSTLEKQVAANTHGAGGNAAGSKSLALAPTGFAYAGSVAISGALAGSPAPLAPGAEP
PALDESSSSGSLFATVGSRSSTPQHPPLLTQPRTCGSASPAPQLCSSPRLGALGPLPDSG
KGDLPCEASFSDPESEAKRRIVFTISAGASSAKQSPSSKHSPLPSGARGDGGQGHGPDGR
KRGRRKRASAGTPSLSSSVSPKRRALPSVAGLFTQSSGSPLNLNSMVSNINQPLEITAIS
SPESSLKSSPVPYQDNDQPPVLKKEKPLSQTNGAHYSPLTSDEEPGSEDEPGSARIERKI
ATISLESKSPPKTLENAGGSLAGRKAPLASEPVNSSKWKSTFSPISDLGLAKAADSPLQA
ASALSHNSLFAFRPGLEEPSAADAKLATHSRKSFPGTLPGAGGLSPSSLPASGFALGGGL
AADLSLHSFSDGASLSHKAPEAAGLGAPLSFPGPRGKEGGAAESGPFVNKRQLDGLGPKG
EGGLPTCGPPDKASTAHSKAGKGREREPDVKNGHNLFMAAATAPPAGLLSGPGLAPAASS
AGGAAPSVQTHRPFLGAFAPGPQFALGPMSLQANLGPSVLQSLFSSVPAAGLVHVSTAAT
RLTNSHAMGSFSSGVAGGAVGGN
NT seq 4572 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaagctggagctgaggctcaagtcgcccgtgggggccgagcccgccgtctac
ccgtggccgctgccggtctacgacaaacaccacgatgctgctcatgaaatcatcgagacc
atcagatgggtctgtgaagaaatcccggatctcaagcttgctatggagaattacgtttta
attgactacgataccaaaagctttgagagtatgcagaggctctgtgacaagtacaaccgg
gccatcgacagcatccaccagctgtggaagggcaccacacagcccatgaagctgaacaca
cggccatccacggggctcctgcggcacatcctgcagcaggtctacaaccactcagtgacc
gaccctgagaagctcaacaactacgagcccttctccccagaggtgtatggggagacctcc
ttcgacctggtcgcccagatgatcgatgagatcaagatgaccgaagatgacctgttcgtg
gacctgggcagtggagtgggccaggttgtgctgcaggttgccgcggccaccaactgcaaa
catcactacggtgtagagaaagctgacatcccagccaagtacgcggagaccatggaccga
gagttcaggaagtggatgaaatggtatggaaaaaagcatgcagaatacacactggagagg
ggggacttcctctcggaggagtggagagaacggattgctaacacaagtgttgtatttgtg
aataactttgcctttggtcctgaggtggatcaccagctgaaggagcggtttgcaaacatg
aaggaaggtggcagaatcgtgtcctcgaagccctttgcgcctctgaacttcagaataaac
agtagaaacttgagtgacatcggcaccatcatgcgcgtcgtggagctgtcgccgctaaaa
ggctcggtgtcatggacggggaagccagtctcctactacctgcacaccatcgaccgcacc
atacttgaaaactatttttctagtctaaaaaatccaaaactcagggaggaacaagaggca
gctcggcgccggcagcagcgggagaacaagagcaacacaaccacgcccaccaaggtgccc
gagagcaaggcagctgtgccggcggacacccccgtggactctggtgctgaggaggagaaa
gccgggacggccactgtcaagaagccatctccctccaaggcccggaagaagaagctgaac
aagaagggccggaagatggtgggtcggaagcgtgggcgccccaagaagatgagtgccacc
aaccccgagcgcaagcccaagaagacccagagctcactggacctgctgcacgcccagacc
gcgtcacgagcggcctcccccttgccgcaggacgcgcacaggccacctcacagcccattc
taccagctacctcccagcgtgcagcggcctacccccgagcagctgctgctggcacccacc
ccgcccgcactgcacaggctgctagagtccttcaggattcagtacctacagttcctggca
tacacgaagacccctcagtacaaggccagcctgcagcagctcctggaccaggagaaggag
aagaatgcccggttgctaggcgcagcgcagcagctatttggccactgccaagctcagaag
gaggagatcaagaggctcttccagcagaaactggacgagctgggagtgaaggcgctgacc
tacaacgacctgatccaagcgcagaaggagatctcggctcacaaccagcagttgagggag
cagacggagcagctggagaagggcaactgggagctgaggagccagagcctgaggctgctc
aaggcacgatgcgaggagctgaagctggactggtccacgctgtcgctggagaatctgctg
aaggagaagcaggccctgaagagccagatctcagagaagcagaggcactgcctggagctg
cagatcagcatcgtggagctggagaagagccagcggcagcaggagttgctgcagctcaag
tcctgcgtgccgcctgatgaggcactggctctgcagcttcgtgggaagccagaggctgag
cctagccggctgcacttggagctggactgcgcccgcttctccctgccacccttcagcagc
ttgagccccgagctctctatgaatggccacgcagccggctatgagctctgcagcgcactg
ggtcggccctcgcccaagcagaacaccccccagtacctggcctccccgctagaccaggag
gtcgtgccctgcacccctagccacagcggccggccacggctagagaagctgtccagcctg
gccctgcctgactacaccaggctatcccctgccaagctggtgctgcggcgccacctgagc
caggaccacgcggccagtggcaaggcagctgccagtgagctgcacccacgagccgagcat
gccaaggagaatgggctcccttaccagagccctggcatcactaatggcatcaagctgagc
ccacaagacccccgaccttcatcccccacggctttacagatgggagagaagggccccgag
aagggtgtgaaggagcgtgcctacgccagcagtggggaggccatcaccagcctgcccgtc
agcatcccgctgagcaccgtgcagcccagcaagctgcccgtcagcatccccctggccagc
gtggtgctgcccagccgcgccgagaaggcgagaagcacacccagccctgggccaccggcc
cgagagtcctcatccacgctggagaagcaggtggctgctaacacccatggtgccgggggc
aacgctgctgggagcaagagcctcgccctggctcccacaggctttgcatacgccggctcg
gtggccatcagtggggccctggccggcagcccggcacccctcgcccctggagccgagccc
ccagccctggacgagtcctccagctctggaagcctctttgccaccgtggggtcccgcagc
tccaccccgcagcacccacccctgctgacgcagccacgcacctgtggctcggcctcgcca
gccccccagctctgctccagcccccggcttggcgctctgggcccactccccgactctggc
aaaggggacctgccctgcgaggccagcttctcagaccctgagagcgaagccaaaaggaga
atcgtcttcaccatctcggcgggcgccagcagcgccaagcagtcaccttccagcaaacac
agccctctgccgtcgggtgcccgcggggacggtggccagggccatgggccagacggccgc
aagcggggccggaggaagcgggcatcggcagggacccccagcctgagctcgagtgtgtcc
cccaagcgccgggccttgccatctgtcgctgggcttttcacgcagtcttcagggtccccc
ctgaacctcaactccatggtcagcaacatcaaccagcccctggagatcacagcaatctcg
tcccctgagagctccctaaagagctcacccgtcccctaccaggacaacgaccaaccaccc
gtgctcaagaaggagaagcccctgagccagaccaatggtgcccactactccccactgact
tcggacgaggagccaggctctgaggatgagcccggcagtgccagaattgagagaaaaatt
gcaacgatctccttagaaagcaagtctccgccaaaaaccttggaaaatgcaggtggcagc
ctagcaggaaggaaggcgccgctggccagcgagccggtcaacagcagcaagtggaagtcc
accttctcacccatctccgacctgggcctggccaaggcggccgacagcccgctgcaggct
gcctctgctctgagccacaactctctgttcgctttccggcctggcctggaggagcccagt
gcggccgatgccaagctggccacccactccaggaagagcttcccgggcaccctgccaggg
gcgggcgggctgagccccagtagccttcctgccagcggcttcgccctgggcgggggccta
gcagctgacctcagtttacacagcttcagtgatggtgcttctctctcccacaaggccccc
gaggcagctggcctgggtgcccccctgagcttccccggcccacggggcaaagagggtggc
gctgcagagtctggccccttcgtgaacaagcggcagctggacggactgggcccaaaaggc
gaggggggccttcccacatgcggacccccggacaaggcctccacagcgcatagcaaggca
ggcaagggccgcgagcgcgagcctgacgtcaagaacggccacaacctgttcatggccgct
gccactgcgccccctgcaggcctcctcagcggcccaggtcttgccccagcggcatcctcg
gcaggtggcgcagccccgtccgtgcagacccaccgccccttcctgggcgccttcgccccc
gggccacagttcgcactgggccccatgtcgctacaggccaacctgggcccatctgtgctg
cagtccctgttcagttccgtgcccgccgccggcctggttcacgtctcgaccgccgccacc
agattgaccaactcgcacgccatgggcagcttctcctctggggtggccggcggcgcagtt
ggaggtaactag

DBGET integrated database retrieval system