KEGG   Bos taurus (cow): 511037Help
Entry
511037            CDS       T01008                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
bta  Bos taurus (cow)
Pathway
bta05164  Influenza A
bta05202  Transcriptional misregulation in cancer
bta05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    511037 (TMPRSS2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    511037 (TMPRSS2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    511037 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bta01002]
    511037 (TMPRSS2)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     511037 (TMPRSS2)
Peptidases [BR:bta01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   511037 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Trypsin_2 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 511037
NCBI-ProteinID: NP_001075054
BGD-bta: BT22202
Ensembl: ENSBTAG00000009132
VGNC: 36140
UniProt: A2VDV7
LinkDB All DBs
Position
1
AA seq 490 aa AA seqDB search
MALNSGSSPGVGPYYENHGYQPESLYPQQPPTAPPAFEVYPAQYYPPVVPQYTPRVQTHA
STPVIYRQPKPPSRTACTSKTKKALCITFTLVVLLAGAILAAVLLWKYMEDECSGMECSS
SGTCVSPSLWCDGILHCPSGEDENRCVRLYGPNFILQVYSAQRKSWHPVCQDDWSESYGR
AACQDMGYRNSFYSSQGIADDSGATSFMKLNISANDIDLYKKLYHSDVCSSKTVVSLRCI
ECGVSVKTSRQSRIVGGSNAYSGEWPWQVSLHVQGIHVCGGSIITPEWIVTAAHCVEEPL
NNPKIWVAFAGILKQSYMFYGSGYRVAKVISHPNYDSKTKNNDIALMKLQTPLTFNDKVK
PVCLPNPGMMLEPTQSCWISGWGATYEKGKTSDDLNAAKVHLIEPRKCNSKYMYDNLITP
AMICAGYLRGTVDSCQGDSGGPLVTLKSSVWWLIGDTSWGSGCAKAYRPGVYGNVTVFTD
WIYQQMRANS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaactcaggatcatcaccaggtgtcgggccttactatgagaaccatggatac
cagccggaaagcttgtaccctcagcagccgcccacggctccccctgctttcgaggtgtac
cccgctcagtactacccgcccgtggtgccccagtacaccccaagggttcagacgcacgcc
tcgacacctgtcatctacaggcagcccaaacctccatccaggacagcgtgcacctcaaag
actaagaaagccctgtgcatcaccttcaccctggtggtcctgctggcaggagcaatcctt
gccgccgtcctcctctggaagtacatggaggacgagtgttcagggatggagtgcagctcc
tccgggacctgtgttagcccctctctctggtgcgatggcatcctgcactgccccagtggc
gaggacgagaaccgctgcgttcgcctctatggaccgaacttcatccttcaggtgtactca
gcacagaggaagtcctggcaccccgtgtgccaggacgactggagtgagagctacgggagg
gcggcctgccaggacatgggctaccggaacagtttttattctagccaaggaatagcagat
gacagcggagccacaagctttatgaagctgaacataagtgccaatgatatcgatctctat
aaaaaactctaccacagcgatgtttgttcttcaaaaacagtggtttctttacgctgtata
gaatgcggggtctcggtgaagacgagccgccagagccggatcgtgggcggatcgaatgct
tactcgggcgaatggccctggcaggttagcctgcacgtgcagggcatccacgtctgtggg
ggctccatcatcaccccggagtggatcgtgacagccgcgcactgcgtagaggaacctctt
aacaatcccaagatctgggtggcctttgcaggaatcttgaaacaatcttacatgttctat
ggaagtggataccgagtagcaaaagtgatttcccacccaaattatgattccaagaccaag
aacaatgacattgcgctaatgaagctgcagacgcctctgactttcaacgacaaagtgaag
ccagtgtgtctacccaatccaggcatgatgctggagccaactcagtcctgctggatttcc
gggtggggggccacctacgagaaagggaagacctcagatgacctgaacgcggccaaggtg
cacctcattgagccccggaagtgcaacagcaagtacatgtatgacaacctcatcacgccc
gccatgatctgtgcaggctacctgcggggcaccgtcgactcctgccagggtgacagtgga
ggtcctctggtcacactgaagagcagtgtctggtggctgattggagacacgagctggggg
tcaggctgtgccaaggcgtaccgaccgggagtgtacgggaacgtgacagtgttcacagac
tggatctatcaacaaatgagggcaaacagctaa

DBGET integrated database retrieval system