KEGG   Bos taurus (cow): 512459Help
Entry
512459            CDS       T01008                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bta  Bos taurus (cow)
Pathway
bta00250  Alanine, aspartate and glutamate metabolism
bta00410  beta-Alanine metabolism
bta00430  Taurine and hypotaurine metabolism
bta00650  Butanoate metabolism
bta01100  Metabolic pathways
bta04727  GABAergic synapse
bta04940  Type I diabetes mellitus
Module
bta_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    512459 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    512459 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    512459 (GAD2)
   00430 Taurine and hypotaurine metabolism
    512459 (GAD2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    512459 (GAD2)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    512459 (GAD2)
Enzymes [BR:bta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     512459 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 512459
NCBI-ProteinID: NP_001192652
BGD-bta: BT13112
Ensembl: ENSBTAG00000008056
VGNC: 29205
UniProt: F1N6X2
LinkDB All DBs
Position
13
AA seq 585 aa AA seqDB search
MASPGSGFWSFGSEDGSGDPENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESSG
SQPPRATSRKAACSCNQKPCSCPKAEVNYAFLHATDLLPACDGERPTLAFLQEVMDILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMLIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTIGFEAHIDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWYVPPSLRVLDNNEERLSRLSKVAPMIKARMMES
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcccggctctggcttttggtcctttggatctgaagatggctcgggggatccc
gagaaccccggcacagccagggcctggtgtcaggtggcccagaagttcacgggcggcatc
ggaaacaaactgtgcgctctgctctatggagacgccgagaagccggcggagagcagcggg
agccagcccccgcgggccacctcccgcaaggccgcctgctcctgcaaccagaagccctgc
agctgccccaaagcggaggtcaactatgcatttctacacgcaacagatctgctaccagcg
tgtgacggagaaaggcccactttggcgtttctgcaagaggttatggacattttgcttcag
tatgtggtgaagagttttgatagatcaaccaaagtgattgattttcattaccctaatgag
cttcttcaagaatataattgggaattggcagaccaaccacaaaatttggaggaaattttg
atgcattgccaaacaactctaaaatacgcaattaaaacaggacatccaaggtatttcaat
caactttctactggactggatatggttggattagcagcagactggctgacatcaacagca
aacactaacatgttcacctatgaaatcgctccagtatttgtgcttttggaatatgtcacg
ctaaagaaaatgagagaaatcattggctggcctgggggctctggcgatgggatattttct
cctggtggcgctatatccaacatgtacgccatgctgattgcgcgctttaaaatgttcccg
gaagtcaaggagaaaggaatggctgcggtccccaggctcattgccttcacgtctgagcat
agccatttttctctcaagaagggagctgcagccttgggcattggaacagacagtgtgatt
ctgattaaatgtgatgaaagggggaaaatgatcccgtctgaccttgaaagaaggatcctt
gaagccaaacaaaaagggtttgtccctttccttgtgagcgccacggctgggaccactgtg
tatggagcatttgaccccctgttagcggttgctgacatttgcaaaaagtataagatctgg
atgcacgtggatgcagcttggggtgggggattactgatgtctcggaaacacaagtggaaa
ctgagcggcgtggagagggccaactctgtgacctggaatccacataagatgatgggcgtt
cctttgcagtgctctgctctcctggttagagaagagggattgatgcagagctgcaaccag
atgcatgcctcctacctcttccaacaagataaacactacgacctgtcctacgacactgga
gacaaggccttgcagtgcggacgccacgtcgatgtttttaagctctggctaatgtggagg
gcaaaggggaccatcgggtttgaagcacatattgataagtgtttggagctggcggagtat
ttatacaatatcatcaaaaaccgagaaggttatgaaatggtgtttgatggaaagcctcag
cacaccaatgtctgcttctggtacgtacctccgagcttgcgtgtcctggacaacaatgaa
gagagactgagccgcctctccaaggtggctcccatgattaaagccaggatgatggagtct
gggaccacaatggtgagctaccagcccttgggtgacaaggtcaacttcttccgcatggtc
atctcaaaccccgcagcaactcaccaagacattgacttcctgattgaagaaatagaacgc
ctgggacaggatttataa

DBGET integrated database retrieval system