KEGG   Bos taurus (cow): 512613
Entry
512613            CDS       T01008                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
bta  Bos taurus (cow)
Pathway
bta01522  Endocrine resistance
bta04012  ErbB signaling pathway
bta04066  HIF-1 signaling pathway
bta04068  FoxO signaling pathway
bta04110  Cell cycle
bta04151  PI3K-Akt signaling pathway
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta04934  Cushing syndrome
bta05162  Measles
bta05165  Human papillomavirus infection
bta05169  Epstein-Barr virus infection
bta05200  Pathways in cancer
bta05202  Transcriptional misregulation in cancer
bta05203  Viral carcinogenesis
bta05206  MicroRNAs in cancer
bta05215  Prostate cancer
bta05220  Chronic myeloid leukemia
bta05222  Small cell lung cancer
bta05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    512613 (CDKN1B)
   04066 HIF-1 signaling pathway
    512613 (CDKN1B)
   04068 FoxO signaling pathway
    512613 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    512613 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    512613 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    512613 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    512613 (CDKN1B)
   05206 MicroRNAs in cancer
    512613 (CDKN1B)
   05203 Viral carcinogenesis
    512613 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    512613 (CDKN1B)
   05220 Chronic myeloid leukemia
    512613 (CDKN1B)
   05215 Prostate cancer
    512613 (CDKN1B)
   05222 Small cell lung cancer
    512613 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    512613 (CDKN1B)
   04934 Cushing syndrome
    512613 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    512613 (CDKN1B)
   05169 Epstein-Barr virus infection
    512613 (CDKN1B)
   05165 Human papillomavirus infection
    512613 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    512613 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 512613
NCBI-ProteinID: NP_001093816
BGD-bta: BT28157
Ensembl: ENSBTAG00000018254
VGNC: 27143
UniProt: A6QLS3
LinkDB
Position
5
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFKNHKPLEGKYEWQEVEKGSLPEFYHRPPRPPKGACKVPAQEGQDASGARPAVPLLG
SQANPEDTHLVDQKTDAPDSQTGLAEQCPGIRKRPAADDSSPQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagtccgagcctggagcggatggacgccagacag
gcggagtaccccaagccctcggcttgcagaaacctctttggcccggtcaatcacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggccagccagcgcaagtgg
aattttgattttaagaatcacaagcccctggagggcaagtacgagtggcaggaggtagaa
aagggcagcctgcccgagttctaccacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggaaggccaggatgccagcggggcccgcccggcggtccctttacttggg
tctcaggcaaacccagaggacacgcatttggtcgatcagaagactgatgccccggacagc
cagaccgggttagcggagcagtgccctgggataaggaagcgacctgccgcagatgattcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttcccccaac
gccggttcagtggagcagacgcccaagaagcctggcctcagaaggcgtcagacgtaa

DBGET integrated database retrieval system